QUANTUM CHROMODYNAMICS AND MULTIPLICITY DISTRIBUTIONS

I.M. Dremin

P.N.Lebedev Physical Institute, Moscow 117924, Russia

Contents

1. Introduction
2. Definitions and notations
3. Phenomenology
3.1. KNO–scaling and F𝐹F–scaling
3.2. Conventional distributions
3.2.1. Poisson distribution
3.2.2. Negative binomial distribution
3.2.3. Fixed multiplicity
3.3. Some models
4. Equations of quantum chromodynamics
5. Gluodynamics
5.1. Approximate solutions of equations with fixed coupling constant and the shape of the KNO–function
5.2. Higher order approximations with running coupling constant
6. Approximate solutions of QCD equations with running coupling constant
7. Exact solutions of QCD equations with fixed coupling constant
7.1. First moments and the ratio of average multiplicities in gluon to quark jets
7.2. Higher order moments and widths of distributions in gluon and quark jets
8. Experiment
9. Evolution of distributions with decreasing phase space -
intermittency and fractality
10. Brief discussion of other QCD effects
11. Conclusions

Abstract

Quantum chromodymamics (QCD) approach to the problem of multiplicity distributions in high energy particle collisions is described. The solutions of QCD equations for generating functions of the multiplicity distributions in gluon and quark jets are presented for both fixed and running coupling constants. The newly found characteristics very sensitive to distribution shapes is discussed. The predictions are confronted to experimental data. Evolution of the multiplicity distributions with decreasing phase space windows is considered and discussed in connection to the notions of intermittency and fractality. Some other QCD effects are briefly described.

\Section

Introduction

Quantum chromodynamics (QCD) has been treated for a long time as the theory of strong interactions. Its numerous successes in describing the static properties of hadrons (especially, those of heavy quarkonia), the symmetry features of their interactions, the sum rules are very impressive. Discovery of the asymptotic freedom of quantum chromodynamics has led to theoretical foundation of the formerly phenomenological parton model and has opened the way for usage of the perturbation theory when applied to hadron processes with high transferred momenta where quarks and gluons play the role of partons [1-5]. Certainly, the transition of quarks and gluons to experimentally accessible hadrons at the final stage of evolution should be considered, and we are still unable to treat it in a unique way since the problem of confinement has not been solved in the framework of quantum chromodynamics even though lattice calculations tell us that it is an inherent property of QCD. The simplified estimates show, however, that either this stage does not change drastically the final results or its impact does not depend strongly on energy and therefore can be estimated from other processes at different energies. Phenomenologically, the distributions of partons and hadrons seem remarkably similar somehow. In such a situation, the study of the partonic stage of the cascade becomes of uppermost importance because the final properties of multiple production of hadrons at high energies are determined to a great extent by the partonic cascade.

The distribution of inelastic events according to the number of produced particles (for the sake of brevity it is called the multiplicity distribution) is one of the most important features revealing the dynamics of the interaction. Phenomenological approaches to its description originate usually from the simplified ideas about particle emission by several sources and exploit some distributions widely used in probability theory (see, e.g., [6]). Among them, the negative binomial distribution is one of the most popular distributions because it describes reasonably well the experimental data for various reactions in wide energy intervals, when its parameters are fitted, though there is some discrepancy at the highest accessible energies. The attractive feature of the negative binomial distribution is the KNO–scaling at asymptotically high energies, i.e. at average multiplicity tending to infinity. According to the KNO–hypothesis (called by the first letters of the names of its authors [7]), the multiplicity distributions depend on the ratio of the number of particles to the average multiplicity only (it is explained in more detail below). In general features, that property has been confirmed by experiment too (probably, except some data at highest energies).

What does quantum chromodynamics tell us about multiplicity distributions? Some attempts to find an answer to it have been undertaken in those papers which constitute the main content of the present review paper. It appears that quantum chromodynamics when treated in higher order approximations at the partonic level has been able to predict some very delicate features of multiplicity distributions which happen to be valid qualitatively for hadrons as well. Before delving into the details of the conclusions, let us point out some ”underwater stones” and describe in brief the history of the problem.

First of all, one should always keep in mind that quantum chromodynamics provides conclusions about parton (quark and gluon) distributions but not about final hadrons as it has been mentioned already. One has to use additional assumptions to get from them the knowledge of experimentally accessible values. One of them is the hypothesis about the local parton-hadron duality [8] which claims that one should just renormalize the parton distributions without changing their shape to get hadron distributions. It originates from ideas of ”soft” preconfinement [9] when partons group in colourless clusters without disturbing the initial spectra. Phenomenological models of hadronization have been attempted in Monte Carlo versions of inelastic processes and, in most cases, they support the approximate property of the local parton-hadron duality even though there exist some quantitative differencies from that hypothesis as it is described below.

Another problem, tightly connected to the first one, is the limitations of the perturbation theory analysis in a definite approximation. Formally speaking, one can apply the perturbation theory just when the coupling constant is very small. That condition is fulfilled in quantum chromodynamics for extremely large transferred momenta only. In each process, however, the energy of cascading partons degrades during their evolution and one has to take into account in a proper way soft partons, their recoil due to interaction and energy-momentum conservation laws. All these factors used to be neglected in the lowest order approximation when the processes with high gradient of energies and of emission angles at each stage of the evolution are considered only (the so-called double logarithmic approximation). An account of soft partons and of strict angular ordering is done in the next terms of the perturbation theory series such as modified leading logarithm approximation and next-to-next-to leading terms. The recoil effects and conservation laws are taken into account at that stage too.

In most cases those corrections are well under control and constitute tens per cents of the main term. In spite of rather low integral contribution, they are, nevertheless, very important on the qualitative level drastically changing the whole situation in the region where the corresponding functions are small. For example, they become crucial for proper restoration of the multiple production processes. It reveals itself mathematically as a new expansion parameter equal to the product of the coupling constant (to be more precise, of its square root) and the rank of the moment of the distribution. Thus it is large at large ranks, i.e. at high multiplicity. We shall describe these problems in more detail in Sections 3–5.

That is why the very first results on multiplicity distributions of partons in quantum chromodynamics were obtained using double logarithmic approximation (see reviews in [5, 10]). They are both impressive and discouraging. First, they proclaim the asymptotical KNO–scaling of the distributions which does not depend on the value of the coupling constant at all [11]. One is tempted to speculate about somewhat more general meaning of the result. However, it fails to be valid in higher-order approximations. The energy increase of the average multiplicity depends on the coupling constant. It is faster than any logarithmic function and slower than any power-like one (if the running coupling constant is used) what agrees quite well with experimental findings. At the same time, the shape of the KNO–function contradicts to any experimental distributions because it is much wider than any of them. Just recently, it became possible to resolve the problem [12, 13] by proper account of the higher order effects mentioned above. In any case, one can state now that the agreement with experiment is achieved at the qualitative level, at least. Moreover, some qualitative predictions of the perturbative quantum chromodynamics are unexpectedly well suited for ”soft” hadronic processes as well. From one side, it puzzles even though one recognizes that higher order corrections should take into account ever softer partons in a consistent way. From another side, it implies, probably, the more general nature of soft and hard processes than it has been imposed on various theoretical schemes and persuades to reconsider our approaches to the origin of effects under consideration (leading, for example, to the experimentally observed multiplicity distributions). Besides, the newly found characteristics prompted by solutions of QCD equations are extremely sensitive to tiny details of the multiplicity distributions. The modern state of affairs for the multiplicity distributions in quark and gluon jets described by quantum chromodynamics is the main concern of the present article (see Sections 5–8).

What concerns the average multiplicities, many discussions are devoted to the value of the ratio of average multiplicities in gluon and quark jets. Its initial value obtained in the double logarithmic approximation is equal to 9/4. It strongly exceeds all experimental estimates. The simplest corrections reduce that value by about ten per cents. Even stronger decrease of it has been predicted by the exact solution of the equations for generating functions in the case of fixed coupling and by the higher-order approximations with running coupling constant. Its derivation and correspondence to experimental data is discussed in Sections 6, 7. The energy dependence of the average multiplicity is considered there also.

For the sake of completeness, one should mention other interesting facts of inelastic interactions of high energy particles which are successfully described (and sometimes predicted) by quantum chromodynamics. Effects predicted by quantum chromodynamics are very exquisite, sometimes unexpected and always extremely instructive. When studying the multiplicity distributions, one is eager to ask about their behaviour not only in the total phase space but in its smaller subregions too. It is well known that these studies are very popular nowadays. They are related to intermittency phenomenon and to fractality of particle distributions within the small phase space volume. It results from enlarged fluctuations in such phase space regions (for the latest review see [14]). Those features are caused by the relative widening of the multiplicity distributions in smaller phase space volumes. It gives rise to the increase of their moments in a power-like manner directly revealing properties of intermittency and fractality. Such tendencies have been experimentally observed. Quantum chromodynamics describes the increase of the moments, relates the intermittency exponents (or fractal dimensions) directly to the anomalous dimension and clearly depicts the region of applicability of those regularities indicating the scales at which one should take into account the running coupling constant or consider it as a fixed one. We describe these results briefly in Section 8.

Quantum-mechanical origin of the interacting partons reveals itself in various interference effects. They lead to the hump-backed plateau of rapidity distributions, to the correlations of partons in energies and azimuthal angles, to the string (or drag-)-effect in the three-jet events and in production of heavy bosons and lepton pairs at large transverse momenta, to the suppression of forward production of accompanying particles in processes with heavy quarks. We describe them briefly in Section 9. Unfortunately, all peculiarities of interactions with nuclei as well as interactions of polarized quarks are not even mentioned in the paper to keep it in a reasonable shape. They deserve a separate publication.

My main concern here are the multiplicity distributions and related characteris tics. I apologize to all authors of numerous papers on multiplicity distributio ns whose contribution has not been mentioned. My only excuse stems from the intention to describe just quantum chromodynamics approach to the subject. Even there, some omissions could happen unintentionally, unfortunately.

\Section

Definitions and notations

The distribution of the number of particles produced in high energy inelastic events is called the multiplicity distribution and is given by the formula

Pn=σnn=0σn,fragmentsP𝑛fragmentsσ𝑛fragmentsfragmentsn0σ𝑛,P_{n}=\frac{\sigma_{n}}{\sum_{n=0}^{\infty}\sigma_{n}}, (1)

where σnfragmentsσ𝑛\sigma_{n} is the cross section of n𝑛n-particle production processes (the so called topological cross section) and sum is over all possible values of n𝑛n so that

n=0Pn=1.fragmentsfragmentsn0P𝑛1.\sum_{n=0}^{\infty}P_{n}=1. (2)

Sometimes it is more convenient to replace the multiplicity distribution by its moments, i.e. by another set of numbers obtained from it by the definite algorithm. All such sets can be obtained from the so called generating function defined by the formula

G(z)=n=0Pn(1+z)n,fragmentsG(z)fragmentsn0P𝑛(1z)𝑛,G(z)=\sum_{n=0}^{\infty}P_{n}(1+z)^{n}, (3)

which substitutes the analytical function in place of the set of numbers PnfragmentsP𝑛P_{n}.

In what follows we shall often use the (normalized) factorial moments FqfragmentsF𝑞F_{q} and cumulants KqfragmentsK𝑞K_{q} determined from the generating function G(z)fragmentsG(z)G(z) by the relations

Fq=nPnn(n1)(nq+1)(nPnn)q=1nqdqG(z)dzq|z=0,fragmentsF𝑞fragments𝑛P𝑛n(n1)(nq1)fragments(𝑛P𝑛n)𝑞1fragmentsn𝑞fragmentsd𝑞G(z)fragmentsdz𝑞|fragmentsz0,F_{q}=\frac{\sum_{n}P_{n}n(n-1)...(n-q+1)}{(\sum_{n}P_{n}n)^{q}}=\frac{1}{\langle n\rangle^{q}}\frac{d^{q}G(z)}{dz^{q}}|_{z=0}, (4)
Kq=1nqdqlnG(z)dzq|z=0,fragmentsK𝑞1fragmentsn𝑞fragmentsd𝑞G(z)fragmentsdz𝑞|fragmentsz0,K_{q}=\frac{1}{\langle n\rangle^{q}}\frac{d^{q}\ln G(z)}{dz^{q}}|_{z=0}, (5)

where

n=n=0Pnnfragmentsnfragmentsn0P𝑛n\langle n\rangle=\sum_{n=0}^{\infty}P_{n}n (6)

is the average multiplicity. The expression for G(z)fragmentsG(z)G(z) can be rewritten as

G(z)=q=0zqq!nqFq(F0=F1=1),fragmentsG(z)fragmentsq0fragmentsz𝑞fragmentsqn𝑞F𝑞(F0F11),G(z)=\sum_{q=0}^{\infty}\frac{z^{q}}{q!}\langle n\rangle^{q}F_{q}\;\;\;\;(F_{0}=F_{1}=1), (7)
lnG(z)=q=1zqq!nqKq(K1=1).fragmentsG(z)fragmentsq1fragmentsz𝑞fragmentsqn𝑞K𝑞(K11).\ln G(z)=\sum_{q=1}^{\infty}\frac{z^{q}}{q!}\langle n\rangle^{q}K_{q}\;\;\;\;(K_{1}=1). (8)

The distribution PnfragmentsP𝑛P_{n} and its ordinary moments CqfragmentsC𝑞C_{q} are derived from the generating function G(z)fragmentsG(z)G(z) according to the formulae

Pn=1n!dnG(z)dzn|z=1,fragmentsP𝑛1fragmentsnfragmentsd𝑛G(z)fragmentsdz𝑛|fragmentsz1,P_{n}=\frac{1}{n!}\frac{d^{n}G(z)}{dz^{n}}|_{z=-1}, (9)
Cq=n=0Pnnqnq=1nqdqG(\ez1)dzq|z=0.fragmentsC𝑞fragmentsfragmentsn0P𝑛n𝑞fragmentsn𝑞1fragmentsn𝑞fragmentsd𝑞G(\e𝑧1)fragmentsdz𝑞|fragmentsz0.C_{q}=\frac{\sum_{n=0}^{\infty}P_{n}n^{q}}{\langle n\rangle^{q}}=\frac{1}{\langle n\rangle^{q}}\frac{d^{q}G(\e^{z}-1)}{dz^{q}}|_{z=0}. (10)

All the moments are connected by definite relations which can be easily derived from their definitions by the generating function. For example, the factorial moments and cumulants are related to each other by the identities

Fq=m=0q1Cq1mKqmFm,fragmentsF𝑞fragmentsm0fragmentsq1Cfragmentsq1𝑚KfragmentsqmF𝑚,F_{q}=\sum_{m=0}^{q-1}C_{q-1}^{m}K_{q-m}F_{m}, (11)

which are nothing else as the relations between the derivatives of a function and of its logarithm at the point where the function itself equals 1. Here

Cq1m=(q1)!m!(qm1)!=Γ(q)Γ(m+1)Γ(qm)=1mB(q,m)fragmentsCfragmentsq1𝑚fragments(q1)fragmentsm(qm1)fragmentsΓ(q)fragmentsΓ(m1)Γ(qm)1fragmentsmB(q,m)C_{q-1}^{m}=\frac{(q-1)!}{m!(q-m-1)!}=\frac{\Gamma(q)}{\Gamma(m+1)\Gamma(q-m)}=\frac{1}{mB(q,m)} (12)

are the binomial coefficients, and ΓΓ\Gamma, B denote the gamma- and beta-functions, correspondingly. Thus there are just numerical coefficients in recurrent relations (11) only and the iterative solution (well-suited for computer calculation) reproduces all cumulants if the factorial moments have been given, and vice versa. In that sense, cumulants and factorial moments are equally suitable. The physical meaning of both of them is clearly seen from their definitions if they are presented in the form of integrals of correlation functions. However we do not write them down here (for review, see [14]) but refer to the analogous relations in quantum field theory where formulae similar to (4) and (5) define the whole set of Feynman graphs (both connected and disconnected ones) and the subset of connected diagrams, correspondingly (see, e.g., [1]). Therefrom it is easy to recognize that the factorial moments are the integral characteristics of any correlations among the particles while the cumulants of q𝑞q-th rank correspond to ”genuine” q𝑞q-particle correlations not reducible to the product of lower order correlations 111This interpretation is valid, however, only for the moments with the rank smaller than the average multiplicity at given energy (for more details, see the review paper [14]).. To be more precise, all q𝑞q particles are connected to each other in the q𝑞q-th cumulant and can not be split into the disconnected groups. One can say that they form the q𝑞q-particle cluster which is not divided in smaller clusters, in analogy with Mayer cluster decomposition in the statistical mechanics.

It is a common feature of distributions in particle physics that their factorial moments and cumulants increase fastly at large ranks q𝑞q. That is why it is convenient to consider their ratio

Hq=KqFq,fragmentsH𝑞fragmentsK𝑞fragmentsF𝑞,H_{q}=\frac{K_{q}}{F_{q}}, (13)

which behaves in a more ”quiet” way at high ranks q𝑞q emphasizing at the same time all typical qualitative peculiarities of cumulants as functions of their rank q𝑞q.

Using the definition of factorial moments (4) one can easily derive their relation to the ordinary moments CqfragmentsC𝑞C_{q} of the same and lower ranks. The coefficients depend on the mean multiplicity so that, for example,

F2=n(n1)n2=C2n1.fragmentsF2fragmentsn(n1)fragmentsn2C2nfragments1.F_{2}=\frac{\langle n(n-1)\rangle}{\langle n\rangle^{2}}=C_{2}-\langle n\rangle^{-1}. (14)

It complicates the whole matter since one should recalculate them at any given energy if the F𝐹F–scaling persists. That is why we do not use the ordinary moments in what follows. In asymptotics, the ordinary and factorial moments coincide, however.

One should keep in mind that the generating function contains the same physical information as the multiplicity distribution. It is true also for unnormalized moments and for their ratio. For normalized moments, one should define the average multiplicity at a given energy. Let us point out that the higher rank moments lay emphasis on higher multiplicity events. The multiplicities nqfragmentsnqn\geq q contribute to the factorial moment of the (integer) rank q𝑞q as is seen from (4). If the distribution is cut off at some n=nmaxfragmentsnnfragmentsmaxn=n_{max}, all factorial moments with the rank q>nmaxfragmentsqnfragmentsmaxq>n_{max} are equal to zero while they are positive at smaller q𝑞q. The cumulants may be either positive or negative.

Up to that moment, without mentioning it, we have assumed that the rank of the moment is an integer positive number. However, the definitions (4), (5), (10) can be generalized to include non-integer moments [15]. It is easily done by rewriting the factorial moments as

Fq=1nqn=0PnΓ(n+1)Γ(nq+1).fragmentsF𝑞1fragmentsn𝑞fragmentsn0P𝑛fragmentsΓ(n1)fragmentsΓ(nq1).F_{q}=\frac{1}{\langle n\rangle^{q}}\sum_{n=0}^{\infty}P_{n}\frac{\Gamma(n+1)}{\Gamma(n-q+1)}. (15)

It is valid at any real value of the rank q𝑞q. The same formula is obtained by applying differentiation of real order q𝑞q (i.e. by using the fractional calculus) to the generating function.

According to the generalized differentiation rule one gets a fractional derivative of any (real) order if the whole set of ordinary derivatives of integer order is known [16]:

DzqG(z)=m=0(1+z)mqG(m)(1)Γ(mq+1),fragmentsD𝑧𝑞G(z)fragmentsm0fragments(1z)fragmentsmqGfragments(m)(1)fragmentsΓ(mq1),D_{z}^{q}G(z)=\sum_{m=0}^{\infty}\frac{(1+z)^{m-q}G^{(m)}(-1)}{\Gamma(m-q+1)}, (16)

where G(m)(1)fragmentsGfragments(m)(1)G^{(m)}(-1) are the derivatives of the integer (positive) order m𝑚m of the function G(z)fragmentsG(z)G(z), defined by eq. (3), at z=1fragmentsz1z=-1. The generalized definition of factorial moments for any real (both positive and negative) non-integer and integer q𝑞q can be written as:

Fq=1nqDzqG(z)|z=0=1nqm=0G(m)(1)Γ(mq+1).fragmentsF𝑞1fragmentsn𝑞D𝑧𝑞G(z)|fragmentsz01fragmentsn𝑞fragmentsm0fragmentsGfragments(m)(1)fragmentsΓ(mq1).F_{q}=\frac{1}{\langle n\rangle^{q}}D_{z}^{q}G(z)|_{z=0}=\frac{1}{\langle n\rangle^{q}}\sum_{m=0}^{\infty}\frac{G^{(m)}(-1)}{\Gamma(m-q+1)}. (17)

The formulae (9), (15), (17) correspond to each other, i.e. the experimental definition of factorial moments by the formula (15) is equivalent to its theoretical definition by (17) as the fractional derivatives of the generating function. At integer ranks one gets the previously used formulae. That is why the generalized (to non-integer ranks) moments are known as fractional moments. Their use could help distinguish various distributions as we discuss later.

The situation with cumulants is more complicated. It is straightforward to define [17] them theoretically as

Kq=1nqDzqlnG(z)|z=0=1nqm=0(lnG(z))(m)|z=1Γ(mq+1).fragmentsK𝑞1fragmentsn𝑞D𝑧𝑞G(z)|fragmentsz01fragmentsn𝑞fragmentsm0fragments(G(z))fragments(m)|fragmentsz1fragmentsΓ(mq1).K_{q}=\frac{1}{\langle n\rangle^{q}}D_{z}^{q}\ln G(z)|_{z=0}=\frac{1}{\langle n\rangle^{q}}\sum_{m=0}^{\infty}\frac{(\ln G(z))^{(m)}|_{z=-1}}{\Gamma(m-q+1)}. (18)

However, the relation between factorial moments and cumulants becomes much more complicated than formula (11) and impractical to use. We should keep in mind that our aim is not to calculate the cumulants themselves but to find the characteristics of multiplicity distributions which are most sensitive to their shape. Therefore, it has been proposed to use the so called ”analytically continued” cumulants denoted by Kq(a)fragmentsK𝑞fragments(a)K_{q}^{(a)} and defined by the recursion relations at any real rank q𝑞q

Fq=m=0[q1](mB(q,m))1Kqm(a)Fm.fragmentsF𝑞fragmentsm0fragments[q1](mB(q,m))fragments1Kfragmentsqmfragments(a)F𝑚.F_{q}=\sum_{m=0}^{[q-1]}(mB(q,m))^{-1}K_{q-m}^{(a)}F_{m}. (19)

The sum is up to the integer part of q1fragmentsq1q-1. As is easily seen from formulae (11), (12), it can be used for any value of q𝑞q, integers including. It is convenient both for experimentalists and theorists after some additional convention. The relation to the ”true” cumulants defined by (18) has been lost, however.

\Section

Phenomenology

\Subsection

KNO–scaling and F𝐹F–scaling

One of the most successful assumptions about the shape of the multiplicity distributions at high energies is the hypothesis that the energy dependence is determined completely by the behaviour of the average multiplicity in such a way that the distribution PnfragmentsP𝑛P_{n} may be represented as:

Pn=1nf(nn).fragmentsP𝑛1fragmentsnf(𝑛fragmentsn).P_{n}=\frac{1}{\langle n\rangle}f(\frac{n}{\langle n\rangle}). (20)

That property has been called the KNO–scaling according to the names of its authors [7] who proposed it relying on Feynman plateau of rapidity distributions. The normalization condition (2) leads to

0f(x)dx=1.fragments0f(x)dx1.\int_{0}^{\infty}f(x)dx=1. (21)

It is clear that the ordinary moments of the KNO–distribution (20) do not depend on energy and are just the functions of their rank q𝑞q

Cq=0xqf(x)dx=\const(E).fragmentsC𝑞0x𝑞f(x)dx\const(E).C_{q}=\int_{0}^{\infty}x^{q}f(x)dx=\const(E). (22)

The factorial moments of the distribution are energy dependent tending to constant values at asymptotically high energies since they differ from the ordinary moments by lower-order correlation terms suppressed by inverse of the average multiplicity to the corresponding power. Constancy of the factorial moments will be called F𝐹F–scaling. It coincides with KNO–scaling in asymptotics. As is clear from definitions (3), (7), (8), the generating function depends on the average multiplicity in both cases only.

In quantum chromodynamics with fixed coupling constant (see section 7), F𝐹F–scaling is preferred. However, the difference from KNO–scaling is usually neglected since the theoretical calculations are often performed for asymptotically high energies. The preasymptotic correction terms in the second moment have been considered in [18].

In the double logarithmic approximation the equations for factorial moments are independent of energy and of coupling constant at all. The corresponding function f(x)fragmentsf(x)f(x) decreases exponentially [5] at large x𝑥x :

f(x)2C(Cx1+13Cx+)\eCx;Cx1,fragmentsf(x)similar-to2C(Cx11fragments3Cx)\efragmentsCx;Cxmuch-greater-than1,f(x)\sim 2C(Cx-1+\frac{1}{3Cx}+...)\e^{-Cx};\;\;\;\;\;Cx\gg 1, (23)

where C2.553fragmentsC2.553C\approx 2.553. At low x𝑥x it behaves as:

f(x)x1exp(ln2x/2).fragmentsf(x)similar-toxfragments1(2x2).f(x)\sim x^{-1}\exp(-\ln^{2}x/2). (24)

Though the very appearance of the KNO–scaling and its independence on coupling constant in the lowest approximation are by themselves the great success of the perturbative quantum chromodynamics [11], the shape of the scaling function (23) does not fit experimentally obtained shapes. Experiment favours the shapes which are much narrower than it is prescribed by (23), (24). The corrections of the modified leading logarithmic approximation indicate that the resulting form should become less wide [19]. It happens that the higher order terms reduce the width of f(x)fragmentsf(x)f(x) but it depends on coupling constant now. Those problems are treated in Sections 5–7.

Up to now, we implicitly assume that we are treating the multiplicity distributions in the total phase space. It is reasonable to ask the question about their evolution if some restrictions are imposed on the region of the phase space under investigation. In particular, one can study such distributions in ever smaller rapidity intervals contained within the total interval. In that case, the moments of the distribution become, in general, the functions of the size of the interval beside their ranks (for review, see [14]). Their behaviour is often related to the notions of intermittency and fractality discussed briefly in Section 9.

\Subsection

Conventional distributions

We shall consider three distributions where analytical expressions for generating functions and all moments can be derived [20],[21]. They will serve us the ”starting points” for further discussion of QCD-distributions. First, we shall describe the moments of the integer rank, and then show what happens with arbitrary (fractional, negative, complex rank) moments.

\Subsubsection

Poisson distribution

The presence of correlations in a process is conventionally described by the difference between its typical distribution and the Poisson distribution which is written as

Pn=nnn!\en.fragmentsP𝑛fragmentsn𝑛fragmentsn\efragmentsn.P_{n}=\frac{\langle n\rangle^{n}}{n!}\e^{-\langle n\rangle}. (25)

The generating function is (see (3))

G(z)=exp(nz)fragmentsG(z)(nz)G(z)=\exp(\langle n\rangle z) (26)

and acccording to (4), (5) one gets

Fq=1,Kq=Hq=δq1.fragmentsF𝑞1,K𝑞H𝑞δfragmentsq1.F_{q}=1,\;\;\;K_{q}=H_{q}=\delta_{q1}. (27)

Therefore the measure of correlations could be defined as the difference between FqfragmentsF𝑞F_{q} and 1 or between KqfragmentsK𝑞K_{q} (HqfragmentsH𝑞H_{q}) and 0. There is exact F𝐹F–scaling and asymptotical KNO–scaling.

The fractional (in general, complex rank) factorial moments of the Poisson distribution [15] are

Fq=\ennqΓ(1q)Φ(1,1q;n),fragmentsF𝑞fragments\efragmentsnfragmentsn𝑞Γ(1q)Φ(1,1q;n),F_{q}=\frac{\e^{-\langle n\rangle}}{\langle n\rangle^{q}\Gamma(1-q)}\Phi(1,1-q;\langle n\rangle), (28)

where ΦΦ\Phi is the degenerate confluent hypergeometric function. At integer positive values of q𝑞q they are equal to 1, as it should be, and oscillate with an amplitude depending on q𝑞q and nfragmentsn\langle n\rangle in the intervals between the integer ranks as it is shown in Fig. 1 ( the curve e𝑒e).

The cumulants [17] are

Kq=qnq1Γ(2q)fragmentsK𝑞𝑞fragmentsnfragmentsq1Γ(2q)K_{q}=\frac{q}{\langle n\rangle^{q-1}\Gamma(2-q)} (29)

and ratios are

Hq=q1qn\enΦ(1,1q;n).fragmentsH𝑞𝑞fragments1qfragmentsn\efragmentsnfragmentsΦ(1,1q;n).H_{q}=\frac{q}{1-q}\frac{\langle n\rangle\e^{\langle n\rangle}}{\Phi(1,1-q;\langle n\rangle)}. (30)

One gets (27) from (28), (29), (30) at integer positive q𝑞q. The amplitude of oscillations of moments decreases fastly with the increase of the average multiplicity. Actually, they originate from quite simple properties of the gamma-function in the denominator.

At large average multiplicity all factorial moments tend to 1 in the whole complex plane q𝑞q. However, cumulants tend to zero only at Req>1fragmentsq1q>1 and increase in absolute value at Req<1fragmentsq1q<1 with the increase of mean multiplicity what can be used for analysis of distributions in the total phase space at high energies. Qualitative features of that kind are typical for other distributions considered below.

\Subsubsection

The negative binomial distribution (NBD)

The negative binomial distribution deserves special attention because it has been actively used during several last years to fit the experimental multiplicity distributions and has been rather successful. In particular, there exists the widely spread opinion that it describes almost all inelastic processes at high energies (except of the data at highest available energies, i.e. for e+efragmentseee^{+}e^{-} at 91 GeV –DELPHI [22], OPAL [23]– and for proton-antiproton interactions at energies from 200 to 900 GeV –UA5 [24]). For NBD we have

Pn=Γ(n+k)Γ(n+1)Γ(k)(nk)n(1+nk)nk,fragmentsP𝑛fragmentsΓ(nk)fragmentsΓ(n1)Γ(k)(fragmentsn𝑘)𝑛(1fragmentsn𝑘)fragmentsnk,P_{n}=\frac{\Gamma(n+k)}{\Gamma(n+1)\Gamma(k)}\left(\frac{\langle n\rangle}{k}\right)^{n}\left(1+\frac{\langle n\rangle}{k}\right)^{-n-k}, (31)

where k𝑘k is an adjustable parameter with a physical meaning of the number of the independent sources. The Bose-Einstein distribution is a special case of NBD with k=1fragmentsk1k=1. The Poisson distribution is obtained from (31) in the limit kfragmentskk\rightarrow\infty. The generating function is

G(z)=(1znk)k,fragmentsG(z)(1fragmentszn𝑘)fragmentsk,G(z)=\left(1-\frac{z\langle n\rangle}{k}\right)^{-k}, (32)

and the (integer rank) moments are

Fq=Γ(k+q)Γ(k)kq,fragmentsF𝑞fragmentsΓ(kq)fragmentsΓ(k)k𝑞,F_{q}=\frac{\Gamma(k+q)}{\Gamma(k)k^{q}}, (33)
Kq=Γ(q)kq1,fragmentsK𝑞fragmentsΓ(q)fragmentskfragmentsq1,K_{q}=\frac{\Gamma(q)}{k^{q-1}}, (34)
Hq=Γ(q)Γ(k+1)Γ(k+q)=kB(q,k).fragmentsH𝑞fragmentsΓ(q)Γ(k1)fragmentsΓ(kq)kB(q,k).H_{q}=\frac{\Gamma(q)\Gamma(k+1)}{\Gamma(k+q)}=kB(q,k). (35)

The factorial moments increase faster than exponent with q𝑞q at a fixed value of k𝑘k. The cumulants are steeply decreasing at small q𝑞q till they reach a minimum at qkfragmentsqkq\approx k and start increasing at larger q𝑞q. They always stay positive. Let us note that the product of several generating functions of negative binomial distributions with different parameters leads also to positive cumulants since the unnormalized total cumulant is just the sum of unnormalized individual cumulants. The ratio HqfragmentsH𝑞H_{q} is positive also and decreases monotonically (as qkfragmentsqfragmentskq^{-k} at large q𝑞q).

In Fig. 2 we show their behaviour by plotting lnFq,lnKqfragmentsF𝑞,K𝑞\ln F_{q},\ln K_{q} and lnHqfragmentsH𝑞\ln H_{q} vs q𝑞q for k𝑘k = 5 and 10. Since PnfragmentsP𝑛P_{n} is narrower at higher k𝑘k, the slower rise of FqfragmentsF𝑞F_{q} for k𝑘k = 10 compared to that for k𝑘k = 5 is expected. The dependence of KqfragmentsK𝑞K_{q} on k𝑘k is more pronounced than that of HqfragmentsH𝑞H_{q}. These properties are more characteristic of NBD than general and do not reveal themselves in quantum chromodynamics.

It should be noted that the negative binomial distribution with the fixed parameter k𝑘k possesses the F𝐹F–scaling (the moments do not depend on energy) and the asymptotical KNO–scaling. The KNO-function at large n𝑛n and fixed values of k𝑘k behaves as {equation] f(x) = \frac{k^k}{(k-1)!}x^{k-1}\e^{-kx} . \label{36} \end{equation} The generating function (\ref{32}) is singular at the point $z=k/\langlen \rangle\rightarrow0$ for $\langlen \rangle\rightarrow0$ and $k=\const$. Therefore, we have to deal in the vicinity of the singularity when calculating its derivatives at $z=0$ (factorial moments). The singularity moves closer to $z=0$ at higher energies. \parThe general expressions for the moments valid for any rank $q$ in the whole complex plane are \begin{equation} F_{q} = \frac{(kv)^k}{\langlen \rangle^{q+k}} \frac{F(1, k; 1-q; v)}{\Gamma(1-q)} = \frac{F(k, -qw; 1-q; -\langlen \rangle/k)}{\langlen \rangle^{q} \Gamma(1-q)} , \label{37} \end{equation} \begin{equation} K_{q} = \frac{k}{\langlen \rangle^{q} \Gamma(1-q)} \@left[\@hidden@bgroup \frac{v}{1-q} F(1, 1; 2-q; v) + \ln(kv/\langlen \rangle)\right@hidden@egroup\@right] , \label{38} \end{equation} \begin{equation} H_{q} = k \@left(\@hidden@bgroup\frac{\langlen \rangle}{kv}\right@hidden@egroup\@right)^{k} \frac{\frac{v}{1-q} F(1, 1; 2-q; v) + \ln(kv/\langlen \rangle)}{F(1, k; 1-q; v)} , \label{39} \end{equation} where $v=\langlen \rangle/(\langlen \rangle+ k)$. \parOscillations of moments between integer values of $q$ diminish at higher average multiplicities (i.e. at higher energies) and at lower values of $k$. It is shown in Figs.1(a-d) for $F_q$. They are really very small at high energies. The oscillations are imposed on fast increase of $F_q$ with $q$. \parAt negative values of $q$ the moments increase with average multiplicity. In the complex plane, their oscillations are noticeable (for example, along lines parallel to the real axis). \par\Subsubsection{Fixed multiplicity distribution} \parWe consider the case of fixed multiplicity just to show that the behaviour of moments (even for integer ranks) can drastically differ from the examples treated above. Besides, it demonstrates how important the role of the selection procedure in experiment could be. Really, it often happens that the events with a given multiplicity are chosen for analysis (so called semi-inclusive events), i.e. one deals with the distribution \begin{equation} P_{n} = \delta_{nn_{0}} \;\;\;\;\;\;\; (n_{0} = \const) . \label{40} \end{equation} Then one gets \begin{equation} G(z) = (1+z)^{n_0} . \label{41} \end{equation} Since $\langlen \rangle= n_0 $, we obtain \begin{equation} F_{q} = \frac{n_{0}!}{n_{0}^{q} (n_{0}-q)!} = \frac{\Gamma(n_{0}) n_{0}^{1-q}} {\Gamma(n_{0}-q+1)} , \;\;\;\;\; 1<q\leqn_{0} , \label{42} \end{equation} \begin{equation} F_{q} = 0 , \;\;\;\;\;\;\;\; q>n_{0} , \label{43} \end{equation} \begin{equation} K_{q} = (-n_{0})^{1-q}(q-1)! = (-n_{0})^{1-q}\Gamma(q) , \label{44} \end{equation} \begin{equation} H_{q} = (-1)^{1-q}n_{0}B(q, n_{0}-q+1) . \label{45} \end{equation} All factorial moments of the rank higher than $n_{0}$ are identically zero and one can calculate $H_q$ at $q\leqn_{0}$ only. The typical feature of that distribution is the alternating signs of integer order cumulants which are positive at odd values of $q$ and negative at even values. The amplitude of oscillations decreases when $q$ increases from 1 to $n_{0}$ and then increases monotonically. The change of the sign (but with a different periodicity) will be seen in QCD as well. Factorial moments, however, behave differently in the two cases. They decrease monotonically with $q$ until $n_{0}$ for fixed multiplicity and increase fastly in QCD. \parIn Fig.3 we show $F_{q}, K_{q}, H_{q}$ for $n_{0}=10$, and in the insets we show $\ln\vertK_q \vert$ and $\ln\vertH_q \vert$ for integer values of $q$. Straight lines connect just the points at integer values of $q$ and are shown to guide the eye. \parLet us stress that the very existence of the oscillations can be related just to the selection procedure of the events and, in the case of fixed multiplicity, has nothing to do with the dynamics of the interaction. It is easy to recognize when one chooses, e.g., 10-particle events only from the set of them with Poisson distribution (or any other). Then we obtain alternating sign cumulants at integer ranks instead identically equal to zero. Their amplitude can preserve the memory about the original distribution if its normalization has been kept untouched. \parThe fractional moments calculated according to their definitions at any rank $q$ (\ref{17}), (\ref{18}) are \begin{equation} F_{q} = n_{0}^{1-q}\frac{B(n_{0},1-q)}{\Gamma(1-q)} , \label{46} \end{equation} \begin{equation} K_{q} = n_{0}^{1-q}\frac{\psi(1) - \psi(1-q)}{\Gamma(1-q)} , \label{47} \end{equation} \begin{equation} H_{q} = \frac{\psi(1) - \psi(1-q)}{B(n_{0},1-q)} . \label{48} \end{equation} For fixed $q$ and $n_{0}\rightarrow\infty$ one gets $F_{q} \rightarrow1 , K_{q}\rightarrow0, H_{q}\rightarrow0$. \parLet us stress that in all the cases considered the non-integer rank moments are not obtained by the simple-minded "analytical continuation" according to the formula (\ref{19}) but are given by the different expressions ( compare (\ref{27}) with (\ref{28})-(\ref{30}), (\ref{33})-(\ref{35}) with (\ref{37})- (\ref{39}) or (\ref{42})-(\ref{45}) with (\ref{46})-(\ref{48}) ) which are derived from the proper definitions (\ref{17}), (\ref{18}). \parThe common property of oscillations between the integer ranks is the change from maximum to minimum at each subsequent rank. At the integer points, there are the knots for Poisson and negative binomial distributions and just maxima or minima for fixed multiplicity. \parUnfortunately, the oscillations between the integer ranks are small at high multiplicity and can be useful for distributions with low average multiplicity like those in small phase space volumes considered in Section 9. At high multiplicity they impose the low-amplitude harmonics on the main dependence, and may be neglected in the first approximation. \parAt the same time, the increase of the negative moments with average multiplicity can be useful for analysis of distributions within the total phase space. \par\Subsection{Some models} \parAt the very first sight, the theoretical diagram description of multiparticle production looks completely different in $e^{+}e^{-}$ and hadron-hadron processes. In the former case, main graphs are of the tree-like type with a highly-virtual initial parton. In the latter case, one used to consider a sequence of the multiperipheral type graphs with low virtualities and rather complicated topology. More general (and unifying) picture emerges from consideration of strings between the colour charges in the process of their interaction (Lund model \@@cite[cite]{[\@@bibref{}{22,23}{}{}]}, dual topological model \@@cite[cite]{[\@@bibref{}{24,25}{}{}]}, quark-gluon string model \@@cite[cite]{[\@@bibref{}{26,27}{}{}]}) and of final particles clusterization (multiperipheral cluster model \@@cite[cite]{[\@@bibref{}{28}{}{}]}, clans \@@cite[cite]{[\@@bibref{}{6}{}{}]}, \@@cite[cite]{[\@@bibref{}{29}{}{}]} etc.). The multiplicity distributions in the models are not described usually by a single analytical formula but are formed from a combination of several distributions. For example, the multiperipheral model with a single ladder gives rise to the Poisson distribution of the particle emission centers (resonances, fireballs, clusters, clans …). In general, the resulting distribution is obtained by convolution of the Poisson distribution of the number of sources with the decay distribution which can describe experimental data quite well for educated guess about decay properties. If one chooses the logarithmic distribution of cluster decay multiplicity then its convolution with Poisson distribution of clusters produces the negative binomial distribution of final particles multiplicities. The simultaneous creation of several ladders (or strings) gives rise to a more complicated shape of the distribution. Sometimes it may be approximated by the sum of the negative binomial distributions with distinct parameters. As a result, the distributions with "shoulders" or "quasi-oscillations" imposed on smooth curves can be observed. The possible relation of such oscillations with those of $H_q$ discussed in the present review has been considered in \@@cite[cite]{[\@@bibref{}{30}{}{}]}. Analogously, a single jet in $e^{+}e^{-}$-annihilation can give rise to the negative binomial distribution while the superposition of several jets differs from it in a resulting shape \@@cite[cite]{[\@@bibref{}{31}{}{}]}. The detailed study of those semi- phenomenological models is usually done with Monte Carlo computing. \par\Section{Equations of quantum chromodynamics} \parThe multiparticle production processes are described in quantum chromodynamics as a result of the interaction of quarks and gluons which leads to creation of additional quarks and gluons forming the observed hadrons at the very last stage. The most typical features of the processes are determined by the vector nature of gluons and by the dimensionless coupling constant. The gluons are colour charged in distinction to photons which have no electric charge. Therefore, they can emit gluons in addition to quark-antiquark pairs. That is why both quark and gluon jets are considered in quantum chromodynamics as main objectives. Their development is described by the evolution equations. The main parameter of the evolution is the opening angle of the jet or its transverse momentum. The subsequent emission of gluons and quarks fills in the internal regions of the previously developed cones so that they do not overlap (angular ordering). This remarkable property can be exploited to formulate the probabilistic scheme for the development of the jet as a whole. Then its evolution equations remind the well-known classical Markovian equations for the "birth–death" (or "mother–daughter") processes. (The detailed discussion of that approach, based on the coherence phenomenon, see in \@@cite[cite]{[\@@bibref{}{5}{}{}]}). \parThe system of two equations for the generating functions $G_F$ and $G_G$ of the quark and gluon jets, correspondingly, are (here A, B, C = F, G) \@@cite[cite]{[\@@bibref{}{1, 5}{}{}]} \begin{equation} G_{A}(y,z) = \e^{-w_{A}(y)}z + \frac{1}{2}\sum_{B,C}\int^{y}dy\prime\int_{0} ^{1}dx \e^{-w_{A}(y)+w_{A}(y\prime)}\frac{\alpha_{S}}{2\pi}K _{A}^{BC}(x) G_{B}(x,y\prime)G_{C}((1-x),y\prime) , \label{49} \end{equation} where $y=\lnp\Theta/Q_0 , p$ is an initial momentum, $\Theta$ is the opening angle of the jet, $Q_{0}=\const, \alpha_{S}$ is the coupling constant. The first term in the right-hand side corresponds to the propagation of the primary parton without any evolution that is described by the form-factor $\exp[-w_{A} (y)]$. The second term shows the creation of two jets $B$ and $C$ with shares of the primary energy $x$ and $1-x$, correspondingly, after their production at the vertex $K _{A}^{BC}$ with the evolution parameter $y\prime$ which has been reached by the primary parton without splitting as is dictated by the factor $\exp[-w_{A}(y)+w_{A}(y\prime)]$. \parMultiplying both sides of the equation by $\exp[w_{A}(y)]$ and differentiating over $y$, we get rid of all form-factors and obtain the final system of equations: \@@cite[cite]{[\@@bibref{}{1}{}{}]},\@@cite[cite]{[\@@bibref{}{5}{}{}]} \begin{equation} G_{G}^{\prime} = \int_{0}^{1}dxK_{G}^{G}(x)\gamma_{0}^{2}[G_{G}(y+\lnx)G_{G} (y+\ln(1-x)) - G_{G}(y)] + n_{f}\int_{0}^{1}dxK_{G}^{F}(x)\gamma_{0}^{2} [G_{F}(y+\lnx)G_{F}(y+\ln(1-x)) - G_{G}(y)] , \label{50} \end{equation} \begin{equation} G_{F}^{\prime} = \int_{0}^{1}dxK_{F}^{G}(x)\gamma_{0}^{2}[G_{G}(y+\lnx) G_{F}(y+\ln(1-x)) - G_{F}(y)] , \label{51} \end{equation} where $G^{\prime}(y)=dG/dy , n_f$ is the number of active flavours, \begin{equation} \gamma_{0}^{2} =\frac{6\alpha_S}{\pi} , \label{52} \end{equation} and the kernels of the equations are \begin{equation} K_{G}^{G}(x) = \frac{1}{x} - (1-x)[2-x(1-x)] , \label{53} \end{equation} \begin{equation} K_{G}^{F}(x) = \frac{1}{4N_c}[x^{2}+(1-x)^{2}] , \label{54} \end{equation} \begin{equation} K_{F}^{G}(x) = \frac{C_F}{N_c}[\frac{1}{x}-1+\frac{x}{2}] , \label{55} \end{equation} where $N_c$=3 is the number of colours, and $C_{F} = N_{c}[1-N_{c}^{-2}]/2 =4/3$ in QCD. \parWe have omitted the variable $z$ in the generating functions. One should keep in mind, however, that the derivation of the equations for moments relies completely on the expansions (\ref{7}), (\ref{8}) when they are inserted into the above equations and the coefficients in front of terms $z^q$ are compared. \parThe typical feature of any field theory with the dimensionless coupling constant (of quantum chromodynamics, in particular) is the presence of the singular terms at $x\rightarrow0$ in the kernels of the equations. They imply the uneven sharing of energy between newly created jets and play an important role in jet evolution. \parEven though the system of equations (\ref{50}), (\ref{51}) is physically appealing, it is not absolutely exact, i.e. not derived from first principles of quantum chromodynamics. One immediately notices it since, e.g., there is no four-gluon interaction term which is contained in the lagrangian of QCD. Such a term would not lead to singular contribution to the kernels and its omission is justified in lowest orders. Nevertheless, the modified series of the perturbation theory (with three-parton vertices) is well reproduced by such equations up to the terms including two- and three-loop corrections. As shown in \@@cite[cite]{[\@@bibref{}{5}{}{}]}, the neglected terms would contribute at the level of the product of, at least, five generating functions. Physical interpretation of the corresponding graphs would lead to treatment of the "colour polarizability" of jets. There are some problems with the definition of the evolution parameter, with preasymptotic corrections etc. (see, e.g., \@@cite[cite]{[\@@bibref{}{32}{}{}]}). The above arguments do not prevent from further detailed studies of higher order corrections to these equations, and it seems reasonable to learn more about the solutions of the equations with higher accuracy since there are indications that neglected terms are not very important. \par\Section{Gluodynamics} \parIt is quite natural to start our studies with the simplest case of gluodynamics. There are no quarks in that case, and interactions of gluons are considered only. The system of equations (\ref{50}), (\ref{51}) degenerates to the single equation \begin{equation} G^{\prime}(y) = \int_{0}^{1}dxK(x)\gamma_{0}^{2}[G(y+\lnx)G(y+\ln(1-x)) - G(y)] , \label{56} \end{equation} where $G(y)\equivG_{G}(y), K(x)\equivK_{G}^{G}(x)$. It is the non-linear integro- differential equation with shifted arguments in the non-linear term which take into account the energy conservation. In the lowest order double-logarithmic approximation, one considers the most singular terms in the kernel $K(x)$ and inside the square brackets, i.e. $1/x$ in $K$ and $\ln(1-x)\rightarrow0$, while $\gamma_{0}^{2}$ is chosen constant {\lx@note{footnote}Somewhat inconsistently, the running coupling constant is sometimes considered in that approximation also (see, e.g., \@@cite[cite]{[\@@bibref{}{1, 5}{}{}]})}. \par\Subsection{Approximate solutions of equations with fixed coupling constant and the shape of the KNO–function} \parFormally speaking, the three assumptions of the double-logarithmic approximation for the terms under the integral sign in (\ref{56}) are equivalent because one neglects non-leading contributions. The detailed analysis of any of them has been done in many papers \@@cite[cite]{[\@@bibref{}{9}{}{}]} - \@@cite[cite]{[\@@bibref{}{13}{}{}]},\@@cite[cite]{[\@@bibref{}{21}{}{}]},\@@cite[cite]{[\@@bibref{}{32}{}{}]} - \@@cite[cite]{[\@@bibref{}{37}{}{}]} one by one or in some combinations. In most papers the lower moments have been treated only, i.e. the average multiplicity and the dispersion. It has been noticed that the role of conservation laws displayed in shifted arguments of the generating functions is the most important one. They provide larger corrections. It was shown recently \@@cite[cite]{[\@@bibref{}{12}{}{}]} that they could be precisely taken into account. However, the running property of the coupling constant was disregarded, the non-singular terms in the kernel were neglected (as well as some other terms) and the difference between the coupling constant $gamma _{0}$ (\ref{52}) and the QCD anomalous dimension $\gamma$ defined as: \begin{equation} \langlen \rangle= \exp(\int^{y}\gamma(y\prime)dy\prime) \label{57} \end{equation} was neglected also. In section 7, we show that equations (\ref{50}), (\ref{51}) possess the exact solutions for fixed coupling constant without any additional assumptions. Nevertheless, it is instructive to consider this case because one gets the analytical expression for the KNO–function which clearly reveals the importance of the conservation laws and differs from the formula (\ref{23}) of the double logarithmic approximation by the smaller width, thus getting much closer to experimental values. \parFirst, we obtain the system of recurrent equations for factorial moments when the relations (\ref{7}) are substituted in the equation (\ref{56}) and the coefficients at $z^q$ are equated in both sides: \begin{equation} (q-q^{-1})F_{q} = \gamma\sum_{l=1}^{q-1} C_{q}^{l}B(\gammal,\gamma(q-l)+1) F_{q-l}F_{l} . \label{58} \end{equation} That system can be computed {\lx@note{footnote}The exact solution of the system of equations for quark and gluon jets is given in section 7.2} with initial conditions $F_{0} = F_{1} = 1$. In the inset of Fig.4a we show their ratio to the asymptotical solution \@@cite[cite]{[\@@bibref{}{12}{}{}]} of the equations (\ref{58}): \begin{equation} F_{q}^{as} = \frac{[\Gamma(1+\gamma)]^{q}}{\Gamma(1+\gammaq)} \frac{2q \Gamma(q+1)}{C^{q}} . \label{59} \end{equation} One obtains at large $q\gamma$ \begin{equation} F_{q}\approx\frac{2\muD^{-q}}{\sqrt{2\pi\gamma}}\Gamma\@left(\@hidden@bgroup \frac{3}{2} +\frac{q}{\mu}\right@hidden@egroup\@right) , \label{60} \end{equation} where $\mu=(1-\gamma)^{-1}, D=C \gamma^{\gamma}(1-\gamma)^{1-\gamma}/ \Gamma(1+\gamma)$. The asymptotics of $F_q$ determines the asymptotics of the KNO–function $f(x)$: \begin{equation} f(x)\approx\frac{2\mu^{2} (Dx)^{3\mu/2}}{x\sqrt{2\pi\gamma}} \exp[-(Dx) ^{\mu}] , \;\;\;\;\;\; (\mu-1)(Dx)^{\mu}\gg1 . \label{61} \end{equation} It is clear to see that the tail of the distribution at large multiplicities is suppressed much stronger than in the double logarithmic approximation. One gets "almost Gaussian" suppression instead the exponent of (\ref{23}) if one considers the practically important values of $\gamma$ for which $\mu= (1- \gamma)^{-1}\approx1.6$. Thus we conclude that conservation laws reduce drastically the width of the multiplicity distribution. It is demonstrated in Fig.5 where the modified distribution (which takes into account the behaviour at low multiplicities \@@cite[cite]{[\@@bibref{}{12}{}{}]}) is compared to the results of the lowest order QCD and to its fit by the negative binomial distribution with the parameter $k=7$. Making use of the modified curve in Fig.5, one is able to compute the "genuine" (with low-multiplicity correction) factorial moments. Their ratio to the asymptotical solution (\ref{59}) is shown in the main part of Fig.4a. Comparison of two curves in that Figure reveals quite important influence of corrections done at low multiplicities. From "genuine" factorial moments, one can compute cumulants and the "genuine" ratio $H_q$ (the latter one is shown in Fig.4b and compared to the negative binomial distribution prediction for $k=7$ and $\langlen \rangle$=30). One notices the visible difference from the negative binomial distribution in the ratios $H_q$ while it is hard to see it in distributions shown in Fig.5. The oscillations of "genuine" $H_q$ contrast its smooth behaviour in negative binomial distribution. Here they remind somewhat the fixed multiplicity toy-model considered above. Similar shapes with oscillations of different (!) periodicity will be discussed in what follows. \par\Subsection{Higher order approximations with running coupling constant} \parThe equation for the generating function in gluodynamics (\ref{56}) can be solved in a somewhat different approximation by taking into account all (including non-singular) terms of the kernel $K$, considering running coupling constant $\gamma_{0}$ distinct from the anomalous dimension $\gamma$, and using the Taylor series expansion for the generating functions in the non-linear term at large $y$: \begin{equation} G(y+\epsilon)\approxG(y) + G^{\prime}(y)\epsilon+\frac{1}{2} G^{\prime\prime}(y)\epsilon^{2} + … \label{62} \end{equation} That approach clearly shows the distinction between various assumptions, their importance and qualitative effects due to the higher order corrections. \parUsing (\ref{62}) for the generating functions in the non-linear term of eq. (\ref{56}), dividing both sides of it by $G(y)$ and differentiating by $y$, we obtain \begin{equation} [\lnG(y)]^ {\prime\prime} = \gamma_{0}^{2}\@left[\@hidden@bgroup G(y)-1-2h_{1}G^{\prime} (y)+\sum_{n=2}^{\infty}(-1)^{n}h_{n}G^{(n)}(y)+\sum_{m,n=1}^{\infty}(-1)^{m +n} h_{nm}\@left(\@hidden@bgroup\frac{G^{(m)}G^{(n)}}{G}\right@hidden@egroup\@right)^{\prime}\right@hidden@egroup\@right] , \label{63} \end{equation} where \begin{equation} h_{1}=11/24, h_{n}=\vert2-2^{-n}-3^{-n}-\zeta(n)\vert; \zeta(n)= \sum_{m=1}^{\infty}m^{-n}, \;\; n\geq2; \label{64} \end{equation} \begin{equation} h_{mn}=\vert\frac{1}{m!n!}\int_{0}^{1}dxK(x)\ln^{n}x\ln^{m}(1-x)\vert. \label{65} \end{equation} Leaving two terms in the right hand side, one gets the well known \@@cite[cite]{[\@@bibref{}{5}{}{}]} equation of the double logarithmic approximation which takes into account the most singular components. The next term with $h_1$ corresponds to the modified leading logarithm approximation, and term with $h_2$ deals with higher order corrections. Let us note that we neglect for the moment the dependence of $\gamma_{0}$ on $y$ in the integral term since it leads to terms of the order of $\gamma_{0}^{2}$ compared to those written above. \parThe straightforward solution of the equation (\ref{63}) looks very problematic even if the terms with $h_1$ and $h_2$ are included in addition to double logarithmic ones only. However, it is very simple for the moments of distributions \@@cite[cite]{[\@@bibref{}{13}{}{}]} since $G(z)$ and $\lnG(z)$ are the generating functions for factorial moments and cumulants, correspondingly. Using the formulae (\ref{7}), (\ref{8}) in case of $F$–scaling one gets the product $q\gamma$ (and its derivatives) at each differentiation of those functions because the average multiplicity is the only $y$-dependent term left. The coefficients in front of $z^q$ in both sides should be equal. Therefrom one obtains \begin{equation} H_{q} = \frac{K_q}{F_q} = \frac{\gamma_{0}^{2}[1-2h_{1}q\gamma+h_{2}(q^{2} \gamma^{2}+q\gamma^{\prime})]}{q^{2}\gamma^{2}+q\gamma^{\prime}} . \label{66} \end{equation} The anomalous dimension $\gamma$ is defined by eq. (\ref{57}). The condition $F_{1}=K_{1}=1$ determines the relation between $\gamma$ and $\gamma_{0}$: \begin{equation} \gamma\approx\gamma_{0} - \frac{1}{2}h_{1}\gamma_{0}^{2} + \frac{1}{8} (4h_{2}-h_{1}^{2})\gamma_{0}^{3} + O(\gamma_{0}^{4}) , \label{67} \end{equation} which shows that the increase of the average multiplicity with energy is slower in the modified leading logarithm approximation as compared to the double logarithmic approximation because the term with $h_{1}$ is negative (see (\ref{57})). However, the higher order terms slightly enlarge it again ($4h_{2}-h_{1}^{2}>0$) but those corrections are not large. The running property of $\gamma_{0}$ has been taken into account in (\ref{67}): \begin{equation} \gamma_{0}^{\prime}\approx-h_{1}\gamma_{0}^{3} + O(\gamma_{0}^{5}) , \label{68} \end{equation} which leads to \begin{equation} \gamma^{\prime}\approx-h_{1}\gamma_{0}^{3}(1-h_{1}\gamma_{0}) + O(\gamma_{0}^{5}) . \label{69} \end{equation} The lesson we learn from the equation (\ref{66}) is that in all "correction" terms (which contain $h_{1}$, $h_{2} …$) the expansion parameter $\gamma$ appears in product with the rank $q\gamma$ which becomes large at high ranks, i.e. at high multiplicities. Therefore for high multiplicity events one should take into account the ever higher order terms in $\gamma$. This problem was mentioned a long time ago \@@cite[cite]{[\@@bibref{}{5}{}{}]} and discussed in some detail in \@@cite[cite]{[\@@bibref{}{38}{}{}]} but only recently it has been analyzed. \parAs was mentioned, the double logarithmic formulae are obtained from eq.(\ref{63}) for $h_{1}=h_{2}=0, \gamma=\gamma_{0}, \gamma^{\prime}=0$. In that case \begin{equation} H_{q}\simq^{-2} . \label{70} \end{equation} It reminds the asymptotics of the negative binomial distribution with rather small value of the parameter $k\approx2$ and corresponds to the extremely wide multiplicity distribution (see (\ref{23})) while experimental data provide values of $k$ ranging from 3.5 to $\sim$100. \parPerhaps, the more interesting feature is the evolution of the qualitative behaviour of the ratio $H_q$ at higher orders. In the modified leading logarithm approximation when $h_{1}$-term has been kept but $h_{2}$-term (as well as higher order ones) neglected in (\ref{63}), we observe that $H_{q}$ crosses the absciss axis, acquires a minimum at \begin{equation} q_{min}\approx\frac{1}{h_{1}\gamma_{0}} + \frac{1}{2}\approx5 \label{71} \end{equation} and tends to zero from below as $\sim-q^{-1}$. If one includes the term with $h_{2}$ too, the ratio $H_{q}$ gets the second zero and tends asymptotically to a positive constant $h_{2}\gamma_{0}^{2}$. It reminds of the situation with expansion of, e.g., $\cosx$ in Taylor series. That is why it does not surprise us that one gets an oscillating behaviour of $H_q$ \@@cite[cite]{[\@@bibref{}{39}{}{}]} when takes into account the higher order terms with $h_3$ and $h_{11}$ in the formula (\ref{63}). The very first minimum reveals just the first oscillation. It is demonstrated in Fig.6. However, it has been shifted to $q\approx4$ in the approximation of \@@cite[cite]{[\@@bibref{}{39}{}{}]} what shows high sensitivity of $H_q$ to various assumptions. Let us emphasize that the amplitudes of extrema and the periodicity of "quasi-oscillations" are different from all those shown in Figs.1 - 4. The analogous behaviour of $H_q$ has been found as the exact solution of QCD equations for fixed coupling constant (see section 7.2). \parThus we have demonstrated in this section that the conservation laws and other higher order terms lead in the framework of gluodynamics to substantial reduction of the width of the multiplicity distribution and to qualitative change of the behaviour of cumulant and factorial moments. \par\Section{Approximate solutions of QCD equations with running coupling constant} \parTransition from gluodynamics to quantum chromodynamics where quarks are created beside gluons leads back to the system of two coupled equations (\ref{50}), (\ref{51}) for the generating functions of quarks and gluons instead of a single equation (\ref{56}). Their structure, however, does not differ, in principle, from the gluodynamics equation described above in detail. That is why we shall not write down all the relations (see, e.g., \@@cite[cite]{[\@@bibref{}{32, 40, 41}{}{}]}), and describe just the results obtained. \parIn complete analogy to gluodynamics, one gets the system of the coupled recurrent equations for factorial moments and cumulants when the Taylor series expansion is used. It has been solved numerically \@@cite[cite]{[\@@bibref{}{40}{}{}]}. The properties of gluon jets do not change noticeably, i.e. their cumulants and factorial moments are very close to those calculated in gluodynamics. Gluon ratio $H_q$ has the minimum at the same value $q\approx$4 or 5. The quark factorial moments are larger than those of gluon jets, i.e. parton multiplicity distribution for quark jets is wider than for gluon jets even though the average multiplicity is smaller there. First minimum of quark cumulants and of their ratio to factorial moments is positioned at $q\approx8$. \parTo apply these results to the real process of the electron-positron annihilation, one should relate its generating function to those for quark and gluon jets. Having in mind the Feynman diagram of production of two quark jets at the very initial stage one would write down \begin{equation} G_{e^{+}e^{-}}\approxG_{F}^{2} , \label{72} \end{equation} with further corrections (see, e.g., \@@cite[cite]{[\@@bibref{}{32}{}{}]}). In that case the zeros of the quark jet cumulants and of $e^{+}e^{-}$ processes coincide because the logarithms of generating functions which determine corresponding cumulants (see (\ref{5})) are proportional to one another. It means that the first minimum for $e^{+}e^{-}$ would lie at $q\geq6$ since the first zero for quark jets is positioned at $q>5$. The analysis of experimental data described below (see Section 8) points out that this is not the case and either relation (\ref{72}) should be revised or the higher order terms in Taylor series expansion become crucial. The latter possibility appears less probable because the similar shift of zeros of quark cumulants has been observed in case of exact solution with the fixed coupling as described in the next section. Independently of it, it seems that the most important conclusion we get from the theoretical studies is the presence of maxima and minima of the ratio $H_q$ which replace each other with some periodicity (but not at neighbouring values of $q$ as it happens for fixed multiplicity). \parIt is interesting to note that the equations for the low order moments give rise to conclusions about the anomalous dimension $\gamma$ and about the ratio $r\equiv\langlen_{G}\rangle/ \langlen_{F}\rangle$ of the average multiplicities in gluon and quark jets \@@cite[cite]{[\@@bibref{}{41}{}{}]}. They have been represented by the perturbative expansion as \begin{equation} \gamma= \gamma_{0}(1-a_{1}\gamma_{0}-a_{2}\gamma_{0}^{2}) , \label{X} \end{equation} \begin{equation} r = \frac{N_c}{C_F}(1-r_{1}\gamma_{0}-r_{2}\gamma_{0}^{2}). \label{Y} \end{equation} The coefficients $a_{i}, r_{i}$ have been calculated \@@cite[cite]{[\@@bibref{}{41}{}{}]}. They are shown in Table 1 together with values of $r$ and $\gamma_{0}$ for various numbers of flavours. Fig.7 demonstrates the $Q$-dependence of $\gamma$ resulting from the solution of the equations in the higher order approximation discussed above. The corresponding behaviour of the average multiplicity is shown in Fig.8. For comparison, the energy ($y$) dependence of the mean multiplicity for fixed coupling constant is drawn by dotted lines. At the very beginning it increases rather slowly but at higher energies its asymptotical increase exceeds that of the running coupling case. It is reliable since the constant has been chosen at rather high energy (mass of $Z^0$) at $y_{Z^0}$= 6.67, i.e. its value is quite small. In real situation, it should increase during the evolution of the jet, but the number of active flavours must decrease. Let us note that these two trends somewhat compensate one another in energy dependence of mean multiplicity. The ratio $r$ of the mean multiplicities in gluon and quark jets is much smaller \@@cite[cite]{[\@@bibref{}{41}{}{}]} than its value in the double logarithmic approximation where it is equal to 9/4. On the average, it is lower by about 20 per cents. The analogous situation is for exact solutions of equations with fixed coupling constant. Therefore we consider that ratio in more detail in the next section. \par\Section{Exact solutions of QCD equations with fixed coupling constant} \parThe above experience with QCD equations treated in various approximations suggests that the conservation laws and non-singular terms of the kernels play more important role than the dependence of the coupling constant on the evolution parameter. It can be shown \@@cite[cite]{[\@@bibref{}{21}{}{}]}, \@@cite[cite]{[\@@bibref{}{42}{}{}]} that the equations (\ref{50}), (\ref{51}) are solved exactly if the coupling constant is fixed. No other assumptions are necessary. One gets the general solution for the moments of any rank but we start with the lowest ranks for pedagogical reasons. \par\Subsection{First moments and the ratio of average multiplicities in gluon to quark jets} \parThe equations for average multiplicities (unnormalized moments of first order) are derived from the system of equations (\ref{50}), (\ref{51}) if one substitutes the generating functions as series (\ref{7}) and equates the linear in $z$ terms with the conditions $F_{0}=F_{1}=\Phi_{0}=\Phi_{1}=1$. (We denote the factorial moments of quark jets by $\Phi_q $ and their cumulants by $\Psi_q$.) If the coupling constant is kept fixed, the average multiplicities behave \@@cite[cite]{[\@@bibref{}{5}{}{}]} as \begin{equation} \langlen_{G}(y)\rangle= \e^{\gammay} ; \;\;\; \langlen_{F}(y)\rangle= \e^{\gammay}/r , \label{73} \end{equation} where the anomalous dimension $\gamma$ and the ratio $r$ are constant. These properties are inherited in equations (\ref{50}), (\ref{51}) as one notices from the relations \begin{equation} \langlen_{G,F}(y+\lnx)\rangle/\langlen_{G,F}(y)\rangle= x^{\gamma} , \label{74} \end{equation} \begin{equation} \langlen_{G,F}(y)\rangle^{\prime} = \gamma\langlen_{G,F}\rangle. \label{75} \end{equation} Then the equations are rewritten as a system of two algebraic equations for two variables $\gamma$ and $r$: \begin{equation} \gamma= \gamma_{0}^{2} [M_{1}^{G} + n_{f}r(M_{1}^{F} - M_{0}^{F})] , \label{76} \end{equation} \begin{equation} \gamma= \gamma_{0}^{2} [L_{2} - L_{0} + rL_{1}] , \label{77} \end{equation} where \begingroup\lx@setcurrenvir{eqnarray*}\@eqnarray@bindings\@@eqnarray\@equationgroup@numbering{numbered=1,preset=1,retract=1,grouped=1,aligned=1}\@start@alignment M_{1}^{G} = \int_{0}^{1} dxK_{G}^{G}[x^{\gamma}+(1-x)^{\gamma}-1] , \\ M_{1}^{F} = \int_{0}^{1} dxK_{G}^{F}[x^{\gamma}+(1-x)^{\gamma}] , \\ M_{0}^{F} = \int_{0}^{1} dxK_{G}^{F} = M_{1}^{F}(\gamma=0)/2 , \\ L_{1} = \int_{0}^{1} dxK_{F}^{G}x^{\gamma} , \\ L_{2} = \int_{0}^{1} dxK_{F}^{G}(1-x)^{\gamma} , \\ L_{0} = \int_{0}^{1} dxK_{F}^{G} = L_{1}(\gamma=0) . \\ \hidden@crcr\@close@alignment\end@eqnarray\endgroup Coefficients $M_{i}, L_{i}$ can be expressed in terms of Euler beta-functions and psi-functions and depend on $\gamma$ only. At fixed $\gamma_{0}$, both $\gamma$ and $r$ are constant. Let us stress that $\gamma$ is not equal to $\gamma_{0}$ even in gluodynamics at $n_{f}=0$ because $M_{1}^{G}$ differs from $\gamma^{-1}$. The approximate equality is valid for $\gamma_{0}\ll1$ but the perturbative expansion for $\gamma$ differs from the corresponding formula (\ref{67}) for the running coupling constant \begin{equation} \gamma\approx\gamma_{0} - h_{1}\gamma_{0}^{2} + \frac{1}{2}(h_{1}^{2}+h_{2}) \gamma_{0}^{3}+O(\gamma_{0}^{4}) , \label{78} \end{equation} wherefrom one sees that the first correction is twice larger. \parThe ratio $r$ appears in equations (\ref{78}), (\ref{79})linearly, and one is tempted to rewrite them as \begin{equation} r(\gamma) = b(\gamma)/ \@left[\@hidden@bgroup\frac{\gamma}{\gamma_{0}^{2}} - a(\gamma) \right@hidden@egroup\@right] , \label{79} \end{equation} \begin{equation} r(\gamma) = \@left[\@hidden@bgroup\frac{\gamma}{\gamma_{0}^{2}} - d(\gamma)\right@hidden@egroup\@right] /c(\gamma) , \label{80} \end{equation} where \begingroup\lx@setcurrenvir{eqnarray*}\@eqnarray@bindings\@@eqnarray\@equationgroup@numbering{numbered=1,preset=1,retract=1,grouped=1,aligned=1}\@start@alignment a = \psi(1)-\psi(\gamma+1)+B(\gamma,1)-2B(\gamma+1,2)-2B(\gamma+2,1)+ B(\gamma+2,3)+B(\gamma+3,2)+11/12-n_{f}/6N_{c} , \\ b = \frac{n_{f}}{2N_{c}}[B(\gamma+3,1)+B(\gamma+1,3)] , \\ c = \frac{C_{F}}{N_{c}}[B(\gamma,1)-B(\gamma+1,1)+B(\gamma+2,1)/2] , \\ d = \frac{C_{F}}{N_{c}}[\psi(1)-\psi(\gamma+1)-B(\gamma+1,1)+ B(\gamma+1,2)/2 +3/4] . \\ \hidden@crcr\@close@alignment\end@eqnarray\endgroup All beta-functions are just the inverse polynomials of $\gamma$ but the above notations are less cumbersome. The solution of the algebraic relations (\ref{79}), (\ref{80}) provides $\gamma$ and $r$ as functions of $gamma _{0}$ and $n_{f}$. Fig.9 shows the dependence of $\gamma$ on $\gamma_{0}$ for $n_{f} $ = 3, 4, 5. The differences for the various values of $n_{f}$ are hardly discernable, being less than the thickness of the visible line. Note that $\gamma$ is significantly different from $\gamma_{0}$. They can be related by the simple fitted formula \begin{equation} \gamma= 0.077 + 0.62\gamma_{0} \label{81} \end{equation} or the more theoretically motivated one (\ref{78}) starting from the linear terms in $\gamma_{0}$ \begin{equation} \gamma= 0.97\gamma_{0} - 0.48\gamma_{0}^{2} + 0.2\gamma_{0}^{3} \label{82} \end{equation} fitted by computer in the range of $\gamma_{0}$ from 0.48 to 0.6. Let us note that $\gamma$ changes very slowly with $\gamma_{0}$. By itself, the value of $\gamma$ is not of much interest even though it is related to the energy dependence of the average multiplicity. However, it is known that the power increase of the mean multiplicity for fixed coupling is replaced by the dependence $\sim\exp(\lns)^{1/2}$ for running coupling. Somehow the reduced value of $\gamma$ compared to $\gamma_{0}$ respects that tendency but the dependence (\ref{73}) can not be used in asymptotics. More realistic behaviour provided by the running coupling has been discussed in the previous section (see Fig.8). \parThe corresponding ratio $r$ is of more interest since the energy dependences of the average multiplicities in gluon and quark jets cancel. That is why its prediction for fixed coupling could be more general. The corresponding result on the ratio $r$ is shown in Fig.10. Again the dependence on $n_{f}$ is very mild, and is exhibited in the expanded scale in Fig.10. More important, the dependence of $r$ on $\gamma_{0}$ is even weaker than that of $\gamma$, and the average effective value is equal to \begin{equation} r = 1.84 \pm0.02 . \label{83} \end{equation} Such a low value of the ratio $r$ should arise interest since in the double logarithmic approximation it is much larger \@@cite[cite]{[\@@bibref{}{5}{}{}]}, and equal to $N_{c}/C_{F}$ =9/4. It has been reduced to 2.05 in the modified leading logarithm approximation \@@cite[cite]{[\@@bibref{}{43}{}{}]},\@@cite[cite]{[\@@bibref{}{44}{}{}]}. The above value shows that the conservation laws diminish the ratio further. Even somewhat lower values of $r$ have been obtained for running coupling (see \@@cite[cite]{[\@@bibref{}{41}{}{}]} and Table 1). \parIn a realistic process, the virtuality in a jet degrades as partons evolve toward hadrons, presumably with the associated change of the number of active quark flavours. In the framework of our calculations with fixed coupling, this dependence could be considered using the formula \begin{equation} \gamma_{0}^{2} = \frac{12}{\beta_{0}y} , \;\;\;\;\; \beta_{0} = 11-\frac{2n_{f}}{3} \label{84} \end{equation} for $y = \lnQ/Q_{0} , Q_{0} = 0.65/\Lambda_{\overline{MS}}$, where we include the dependence of $\Lambda_{\overline{MS}}$ on $n_f$ according to the proportions 63 : 100 : 130 for $n_{f} = 5 : 4 : 3$, respectively \@@cite[cite]{[\@@bibref{}{45}{}{}]}, and we pin the value $\Lambda_{\overline{MS}}$ at 175 MeV for $n_{f} = 5$. We consider the values of $Q$ at $M_{Z}/m$ ($M_{Z}$ being the mass of $Z^{0}$) for $m$ = 1, 2, 4, and 8. The result on $\gamma$ is shown as a function of $\lnQ$ in Fig.11. The dependence on $n_f$ is so small that connection of the different points with different $n_f$ for the same $Q$ results only in short line segments as shown. Thus we learn that as a jet of partons evolves toward lower $Q$, we need not be concerned with the change of the active flavour, and that the parton multiplicity will depend on the evolving virtuality through a mild variation of $\gamma$, but not enough to invalidate fixed coupling approximation. Certainly, in the ratio of the multiplicities, such dependences are cancelled, yielding a stable value of $r$. This conclusion has been supported by the approximate solutions of the equations with the running coupling \@@cite[cite]{[\@@bibref{}{41}{}{}]} as we have discussed already (see Table 1). \par\Subsection{Higher order moments and widths of distributions in gluon and quark jets} \parThe dispersion of the multiplicity distribution is determined by the second moment. Therefore, to get it, one should solve the system of equations (\ref{50}), (\ref{51}) for $q = 2$. However, the relations (\ref{74}), (\ref{75}) prompt us to get the solution for any $q$. In fact, one can obtain the system of coupled recurrent equations \@@cite[cite]{[\@@bibref{}{21}{}{}]} for moments if one substitutes in equations (\ref{50}), (\ref{51}) the generating functions according to (\ref{7}) and compares the coefficients in front of $z^q$ in both sides. Those equations are solved by iteration. It is well suited for computer calculations. We do not write them down here (see \@@cite[cite]{[\@@bibref{}{21}{}{}]}), and show just the final analytical expressions for the moments of the rank $q$ as related to the lower rank moments. For that purpose, let us introduce \begin{equation} f_{q} = F_{q}/q! , \;\;\;\;\; \hat{\phi}_{q} = \Phi_{q}/r^{q}q! . \label{84} \end{equation} The solution of the equation is \@@cite[cite]{[\@@bibref{}{21}{}{}]} \begin{equation} f_{q} = [a_{q}S_{q}(f,\hat{\phi}) + b_{q}T_{q}(f,\hat{\phi})]/\Delta_{q} , \label{85} \end{equation} \begin{equation} \hat{\phi}_{q} = [c_{q}S_{q}(f,\hat{\phi}) + d_{q}T_{q}(f,\hat{\phi})]/\Delta_{q} , \label{86} \end{equation} where \begin{equation} S_{q} = \sum_{l=1}^{q-1}[N_{q,l}^{G}f_{l}f_{q-l} + n_{f}N_{q,l}^{F} \hat{\phi}_{l}\hat{\phi}_{q-l}] , \label{87} \end{equation} \begin{equation} T_{q} = \sum_{l=1}^{q-1}L_{q,l}\hat{\phi}_{l}f_{q-l} , \label{88} \end{equation} \begin{equation} a_{q} = \frac{q\gamma}{\gamma_{0}^{2}} + L_{0,0} - L_{q,q} , \label{89} \end{equation} \begin{equation} b_{q} = n_{f}M_{q}^{F} , \label{90} \end{equation} \begin{equation} c_{q} = L_{q,0} , \label{91} \end{equation} \begin{equation} d_{q} = \frac{q\gamma}{\gamma_{0}^{2}} - M_{q}^{G} + n_{f}N_{0,0}^{F} , \label{92} \end{equation} \begin{equation} \Delta_{q} = a_{q}d_{q} - b_{q}c_{q} , \label{93} \end{equation} \begingroup\lx@setcurrenvir{eqnarray*}\@eqnarray@bindings\@@eqnarray\@equationgroup@numbering{numbered=1,preset=1,retract=1,grouped=1,aligned=1}\@start@alignment M_{q}^{G} = \psi(1) - \psi(q\gamma+1) + B(q\gamma,1) - 2B(q\gamma+1,2) - 2B(q\gamma+2,1) + B(q\gamma+2,3) + B(q\gamma+3,2) +11/12 , \\ M_{q}^{F} = \frac{1}{N_{c}}[B(q\gamma+3,1) + B(q\gamma+1,3)] , \\ N_{q,l}^{G} = B(l\gamma,(q-l)\gamma+1) - 2B(l\gamma+1,(q-l)\gamma+2) + B(l\gamma+2,(q-l)\gamma+3) , \\ N_{q,l}^{F} = \frac{1}{4N_{c}}[B(l\gamma+3,(q-l)\gamma+1) + B(l\gamma+1, (q-l)\gamma+3)] , \\ L_{q,l} = \frac{C_{F}}{N_{c}}[B(l\gamma+1,(q-l)\gamma) - B(l\gamma+1, (q-l)\gamma+1) + B(l\gamma+1,(q-l)\gamma+2)] . \\ \hidden@crcr\@close@alignment\end@eqnarray\endgroup The above expressions look cumbersome {\lx@note{footnote}The gluodynamics formulae are obtained from them in the limit $n_f = C_F = 0$ when leading terms of $M_{q}^{G}$ and of $N_{q,l}^{G}$ are considered only, i.e. $B(q\gamma,1)\equiv1/q\gamma$ and $B(l\gamma,(q-l)\gamma+ 1)$. } but their structure is very simple and clear. They generalize the formulae of the preceding section to any $q$. The formulae of gluodynamics follow from them for $n_{f} = C_{F} = 0$ if one leaves in $M_{q}^{G}$ and $N_{q,l}^{G}$ the leading terms $B(q\gamma,1)\equiv1/q\gamma$ and $B(l\gamma,(q-l)\gamma+1)$. Using the values of $\gamma$ and $r$ from the preceding section at given $\gamma_{0}$ and $n_{f}$, one gets first $F_2$ and $\Phi_2$, and then increases $q$ by 1. \parThe evolution parameter $y$ disappears from the formulae. {\itA'posteriori}, it means that our assumption about $F$–scaling with all dependence on $y$ hidden in average multiplicities $\langlen_{G,F}\rangle(y)$ is correct for fixed coupling. It leads to the self-consistent system of algebraic equations where all quantities, including $F_{q}$ and $\Phi_q$, do not depend on energy. Surely, $F$–scaling is precise at fixed coupling until the main equations are correct. Actually, one should speak about the asymptotic $F$–scaling because the limits of $x$-integration in eqs. (\ref{50}), (\ref{51}) are asymptotic ones. More precise treatment of them would correspond to considering the higher twist effects. \parThe results of calculation, when expressed in terms of $F_q$ and $\Phi_q$, are shown in Fig.12 for $\gamma_{0} = 0.48$ and $n_{f} = 5$. Evidently, they increase rapidly with $q$, more so for $\Phi_q$ than $F_q$. Since these are normalized factorial moments, they imply that the multiplicity distribution for the quark jet is wider than that for the gluon jet, although the average multiplicity in quark jets is lower than in gluon jets. These results are very insensitive to the number of active flavours $n_{f}$. The dependence on the coupling constant is very mild and the results are rather insensitive to coupling constant being fixed or running. \parLet us compare QCD results to those of the phenomenological distributions. By comparing Fig.12 with Fig.2 and Fig.3, the QCD results are clearly of the NBD type rather than the fixed multiplicity. In fact, $F_q$ in Fig.12 can be approximated by the negative binomial distribution with $k=5$. However, it is an apparent coincidence. While the characterization of $F_q$ by the NBD parameter $k$ is convenient, the fits by the negative binomial distribution are inappropriate. Let us recall that the cumulants of the negative binomial distribution decrease at low $q$ and then increase. The ratio $H_q$ decreases monotonically with $q$. \parWe define the corresponding ratios for gluon and quark jets as: \begin{equation} H_{q} = K_{q}/F_{q} , \label{94} \end{equation} \begin{equation} \eta_{q} = \Psi_{q}/\Phi_{q} , \label{95} \end{equation} where $K_{q} (\Psi_{q})$ are related to $F_{q} (\Phi_{q})$ by the formula (\ref{11}). The results of calculations in the fixed coupling QCD are shown in Fig.13 and Fig.14 . \parThe distinctive feature of the behaviour of $H_{q}$ is clearly its oscillations. There are no oscillations for the negative binomial distribution even if it fits the second and third moments quite well. One sees that the fixed multiplicity distribution, which gives rise to oscillations of $H_q$ changing sign at each subsequent integer value of $q$, does not suit us because of wrong values of moments and improper period of oscillations (see the discussion of experimental results in the following section). \parThe sensitivity of $H_q$ to the shapes of the distributions obtained in quantum chromodynamics at different assumptions is clearly demonstrated by its various qualitative forms. It is positive and decreases monotonically as $\simq^{-2}$ in the double logarithmic approximation, acquires a zero and a minimum in the modified leading logarithm approximation tending asymptotically to zero from below like $\sim-q^{-1}$, gets the second zero and constant positive asymptotics due to the next term and starts oscillating in the higher order approximations. \parThe behaviour of $H_q$ depends strongly on slight variations of the particular shape of factorial moments at low values of $q$. One can demonstrate how easy it is to get the oscillations of the fixed multiplicity type imposed on the double logarithmic behaviour by doing the following exercise. It is known \@@cite[cite]{[\@@bibref{}{19, 46}{}{}]} that the large $q$ behaviour of $F_q$ of the factorial moments in the double logarithmic approximation (see (\ref{23})) is \begin{equation} F_{q} = \frac{2q\Gamma(q+1)}{C^{q}} . \label{96} \end{equation} If we add a preasymptotic term by replacing the factor $2q$ by $2q+1$ in the numerator (it restores the condition $F_{0}=1$ but not $F_{1}=1$), one gets an additional term in $H_{q}$ which imposes the oscillations of the fixed multiplicity type on the monotonous decrease of the $q^{-2}$ shape, and the ratio $H_q$ becomes \begin{equation} H_{q} = \frac{2+(-1)^{q-1}}{q(2q+1)} , \label{97} \end{equation} where the second term in the numerator appears due to the newly added preasymptotic term. \parThe above examples show how sensitive $H_q$ is to various approximations made in solving the set of equations for generating functions. Their distinction has been demonstrated in Figs.4, 6, 13, 14, and they strongly differ from the phenomenological distributions shown in Figs.2, 3. Unfortunately, there is still no clear understanding of the physical origin of oscillations, i.e. of their periodicity, amplitude and their dependence on the rank $q$ (it seems that the amplitude increases and the period decreases with $q$). Nevertheless, the exact solution of fixed coupling QCD equations provides clear guide to the realistic behaviour of $H_q$. Perhaps, the behaviour of $H_q$ will show us the ways to generalize the equations for the generating functions including the fine effects of the interaction of "colour monsters" \@@cite[cite]{[\@@bibref{}{5, 19, 46}{}{}]}. \parLet us point out that the above oscillations proceed at integer values of $q$ and are not related to the fractional moments oscillations. The latter ones would impose the lower period harmonics on those oscillations. \par\Section{Experiment} \parThus we have obtained the results for the KNO–function $f(x)$, for the moments of the multiplicity distribution $K_{q}, F_{q}$ and for their ratio $H_{q}$ as well as for the energy behaviour of mean multiplicities (the anomalous QCD dimension $\gamma$) and for the ratio $r$ of the average multiplicities in gluon and quark jets. Before comparing them to experiment one should remind that all above results have been obtained for the multiplicity distributions of partons (gluons and quarks) while experimentators have to deal with hadrons. To translate theoretical predictions to experimentally measured values, one should elaborate a hadronization model describing the transition from partons to hadrons. After that, one can get the quantitative results using Monte Carlo calculations. Sometimes, one relies on the hypothesis of the local parton-hadron duality. It assumes that the distributions of partons and hadrons differ by the numerical coefficient only which is determined by the number of partons recombined in a single hadron. Therefore, it is unimportant for the normalized variables, and the normalized moments of gluon and quark jets should be just related to the moments of observed processes, e.g., to electron-positron annihilation. On the contrary, such values as the average multiplicities in gluon and quark jets are changed in a different way what can vary their ratio also. In such a case one should use some Monte Carlo versions of hadronization. One of them, named Herwig \@@cite[cite]{[\@@bibref{}{47}{}{}]}, has been discussed in \@@cite[cite]{[\@@bibref{}{48}{}{}]} in relation to the ratio of average multiplicities $r$ (\ref{73}) both on parton and hadron levels. Its results are shown in Fig.15. It supports the asymptotical local parton-hadron duality but does not respect it at intermediate energies in exact way. The partonic ratio is equal to $r_{parton}^{MC}\approx1.9$. It shows that the higher order corrections play an important role in Herwig because this value is smaller than those of the lowest order approximations as discussed above. The hadronic ratio is slightly lower in asymptotics. However, it is still much lower at energies of $Z^{0}$ (equal to 1.44) and increases with energy. It shows that the local parton-hadron duality is not yet very accurate. The model describes the bulk of experimental data even though it admits slight revisions. In particular, if one modifies the partonic cascade so that it gives rise to the value of the partonic ratio obtained above $r_{theor}=1.84\pm0.02$ (\ref{83}) and considers the same hadronization model to deal with the same ratio of hadrons to partons $r_{hadron}^{MC}/r_{parton}^{MC}=1.44/1.92$ (see Fig.15), i.e. applies the formula \begin{equation} r_{exp} = r_{theor}(r_{hadron}^{MC}/r_{parton}^{MC}) , \label{98} \end{equation} one obtains \begin{equation} r_{exp} \approx1.38\pm0.02 . \label{99} \end{equation} It agrees quite well with the recently measured \@@cite[cite]{[\@@bibref{}{49}{}{}]} value $1.27\pm0.04 \pm0.06$ (see also \@@cite[cite]{[\@@bibref{}{50}{}{}]}). Therefore we can state that there is no disagreement between theoretical and experimental values of the ratio of average multiplicities in gluon and quark jets any more. Still one should keep in mind that the phenomenologically described hadronization plays an important role reducing this value by 40 per cents when going from partonic to hadronic levels. \parWhat concerns the KNO–function $f(x)$, it becomes narrower when the energy conservation is taken into account in a proper way compared to the double logarithmic approximation as was discussed in Section 5.1. The negative binomial distribution fits it rather well with $k\approx7$ as is seen from Fig.5. Monte Carlo calculations fit experiment as well. However we would like to stress once again that some tiny features escape such a comparison, and they can be revealed when studying the behaviour of the ratio of cumulant to factorial moments $H_q$. \parThese ratios differ for gluon and quark jets as shown in Figs.13, 14. Therefore, they may be used either for selection of those jets, or for the control of validity of their separation done according to other criteria (see, e.g., \@@cite[cite]{[\@@bibref{}{49}{}{}]},\@@cite[cite]{[\@@bibref{}{50}{}{}]}). The qualitative characteristics of the curves are hardly changed by hadronization even though one should confirm it by Monte Carlo calculations that has not been done yet. \parThe way from the generating functions of jets to real processes of hadroproduction is non-trivial one even for $e^{+}e^{-}$-annihilation as has been discussed above, and ever so more complicated for other processes. One can hope that the qualitative features of jet moments are more general. Then it is reasonable to confront them to the corresponding characteristics of multiparticle production processes in attempt to reveal their interrelation and, in particular, the role of hadronization. \parSuch an analysis has been performed \@@cite[cite]{[\@@bibref{}{51}{}{}]} both for $e^{+}e^{-}$-annihilation and for $pp$ (and $p\bar{p}$)-interactions in a wide energy interval to get some guidance to the difference between the processes initiated by leptons and by hadrons. A list of the considered samples of experimental data \@@cite[cite]{[\@@bibref{}{52}{}{}]}– \@@cite[cite]{[\@@bibref{}{65}{}{}]} is given in Table 2. The low statistics samples, yielding large error bars, have been disregarded, and only papers reporting a detailed separation between elastic and inelastic data for low multiplicities have been taken into account. For all the considered experimental multiplicity distributions of secondary hadrons the ratio $H_q$ has been computed up to the 16-th order. It happens that the qualitative features of the behaviour of $H_q$ are very similar in all processes, though the detailed structure depends on the type of the interaction, on primary energy and even on the experimental selection of events. \parAs a first example one may consider the outcomes of the $e^{+}e^{-}$ 91 GeV DELPHI multiplicity distribution \@@cite[cite]{[\@@bibref{}{55}{}{}]} plotted in Fig.16. Due to different order of magnitude involved here, the low-$q$ and high-$q$ regions are plotted using different scales. The polyline in the upper right box displays, up to the fourth order, the abrupt descent of $H_q$ (the scale is logarithmic). In the main reference frame two negative minima (at $q\approx$ 5 and 12) and two positive maxima (at $q\approx$ 8 and 15) are shown. The predictions of the negative binomial distribution are given by the dashed curve shown in Fig.16. The value of the parameter $k$ has been taken from ref.\@@cite[cite]{[\@@bibref{}{55}{}{}]} ($k^{-1}=0.0411\pm0.0012$). No minima or maxima appear, of course, and one is tempted to conclude that the negative binomial distribution is able to reproduce the main details of experimental data at low $q$ but not its tiny details revealed by oscillations at higher $q$. \parFig.17 refers to the $\overline{p}p$ 546 GeV interaction outcomes from the UA5 collaboration \@@cite[cite]{[\@@bibref{}{65}{}{}]}. The main difference with respect to the previous case is the order of magnitude of maxima and minima, whose absolute value is more than ten times larger. Nonetheless, the same main characteristics found for $e{+}e^{-}$-annihilation, i.e. the abrupt descent and the subsequent oscillations, can be observed (here minima are at $q\approx$ 6 and 12 while maxima are at $q\approx$ 9 and 15). Again superimposed (dashed curve) are the negative bimomial yields, here corresponding to the $k$ parameter given in ref.\@@cite[cite]{[\@@bibref{}{65}{}{}]} ($k=3.69\pm0.09$). \parThe similar {\itqualitative} peculiarities have been observed at various energies as shown in Fig.18 and Fig.19. Let us point out that there is {\itquantitative} distinction between the experimental data of different collaborations for the {\itsame} $e^{+}e^{-}$-process at the {\itsame} energy 91 GeV (see the four low graphs in Fig.18). Perhaps, it is related to the selection procedures adopted by various collaborations and to systematical errors. The high sensitivity of the ratio $H_q$ could be exploited, e.g., for optimization of selection criteria. To check their influence, the various Monte Carlo schemes have been confronted to the data about $H_q$. It has happened that ARIADNE which includes the selection criteria of OPAL describes its data in Fig.18g while JETSET suited for DELPHI fits its data in Fig.18f. Since there is quantitative difference between those data, one concludes that it stems from the particular details of experiments but not from the general dynamics of the process at the parton level. The general trend survives various systematics. \parLet us note that the distinction between experimental and negative binomial distributions has been noticed in papers of UA5 \@@cite[cite]{[\@@bibref{}{65}{}{}]}, DELPHI \@@cite[cite]{[\@@bibref{}{55}{}{}]} and OPAL \@@cite[cite]{[\@@bibref{}{57}{}{}]}. The latter collaboration has shown that the difference between the two distributions oscillates. Perhaps it lies at the origin of the oscillations of $H_q$ too. Their physical interpretation could be related to the varying number of subjets in $e^{+}e^{-}$-annihilation (see, e.g., \@@cite[cite]{[\@@bibref{}{31}{}{}]}) or to the number of "ladders-strings" in hadronic processes (see, e.g., \@@cite[cite]{[\@@bibref{}{27}{}{}]}). \parThe more trivial effect of the cut-off of the experimental distributions at large multiplicities could be of importance since it produces some oscillations of $H_q$ also. In distinction to QCD, this effect should, however, vanish at asymptotically high energies. Nevertheless, it requires further study to be done. \parTo conclude, we say that the quantum chromodynamics predictions became more reliable at the qualitative level during the last years and got support from experimental data on multiplicity distributions. There exist now both the proper approach to treatment of various theoretical approximations and some proposals of the selection of experimental data for quantitative comparison with theory predictions. Therefore the solid foundation has been laid for the precise description of the problem as a whole. \par\Section{Evolution of distributions with decreasing phase space – intermittency and fractality} \parThe multiplicity distributions can be measured not only in the total phase space (as it has been discussed above for very large phase space volumes) but in any part of it. For the homogeneous distribution of particles within the volume, the average multiplicity is proportional to the volume and decreases for small volumes but the fluctuations increase. The most interesting problem here is a regularity in the increase of fluctuations, the probable distinction from the purely statistical laws related to the decrease of the average multiplicity. Such a variation has to be connected with the dynamics of interactions. In particular, it has been proposed \@@cite[cite]{[\@@bibref{}{66}{}{}]} to look for the power-law behaviour of the factorial moments for small rapidity intervals $\deltay$ \begin{equation} F_{q}\sim(\deltay)^{-\phi(q)} , \;\;\;\;\;\; (\deltay \rightarrow0) , \label{100} \end{equation} where $\phi(q)>0$. This assumption has been provoked by the analogy to the turbulence in hydrodynamics, where the similar property is known as intermittency and $\phi(q)$ are called the intermittency exponents. It originates from the state of the fluid where the "quiet" regions alternate with the volumes of high fluctuations, and it becomes even more noticeable at smaller sizes. From the point of view of distributions it implies rather strong increase of their width with slower decline at high multiplicities. \parExperimental data on various processes in the wide energy range support the idea by revealing the power-law dependence (\ref{100}). Immediately, several theoretical approaches were developed to explain that phenomenon. The present state of affairs has been described recently in the review paper \@@cite[cite]{[\@@bibref{}{14}{}{}]}. Here we just show how quantum chromodynamics reproduces intermittency \@@cite[cite]{[\@@bibref{}{38,67-71}{}{}]}. \parLet us stress once again that quantum chromodynamics deals with partons (quarks and gluons) while experimental results provide the moments of distributions of hadrons. The local parton-hadron duality hypothesis implies proportionality of inclusive distributions but is not so obvious for correlations and is not fulfilled sometimes in the proposed Monte Carlo schemes. Therefore, we can pretend to get qualitative description on the parton level but not to attempt quantitative comparison to experiment. \parIn contrast to the previous sections, we rely here on the diagrammatic approach instead of the equations for the generating functions. It is caused by the fact that, considering the multiplicity distributions in small phase space volumes, one has to deal with a minor part of the whole parton content of a well developed jet, namely, with those partons which fill in the volume chosen. Surely, the prehistory of a jet as a whole is important for the subjet under consideration as is shown in Fig.20. Here \\ \begin{enumerate} \parthe primary quark (solid line) emits the hard gluon with energy $E$ in the direction of the angular interval $\theta$, but not necessarily hitting the window, \\ \parthe emitted gluon produces the jet of partons with parton splitting angles {\itlarger} than the window size, \\ \paramong those partons there exists such a parton with energy $k$ which hits the window, \\ \parall decay products of the subjet cover exactly the bin $\theta$. \\ \end{enumerate} This picture dictates the rules of calculation of the $q$-th correlator of the whole jet. One should average the $q$-th correlator of the subjet $\DeltaN ^{(q)}(k\theta}overallpossiblewaysofitsproductioni.e.convoluteitwiththeinclusivespectraofsuchpartonsfragmentsoverallpossiblewaysofitsproductioni.e.convoluteitwiththeinclusivespectraofsuchpartonsoverallpossiblewaysofitsproductioni.e.convoluteitwiththeinclusivespectraofsuchpartonsD^θinthewholejetandwiththeprobabilityofcreationofthejet(fragmentsinthewholejetandwiththeprobabilityofcreationofthejet(inthewholejetandwiththeprobabilityofcreationofthejet(α_SK_F^G).Analytically,itisrepresentedby(36)36ΔN(q)(Qθ0,θ0θ)∝∫QdEEαS2πKFG(EQ)∫EdkkDθ(Ek;Eθ0,kθ)ΔN(q)(kθ),wherefragments).Analytically,itisrepresentedby(36)36ΔN(q)(Qθ0,θ0θ)∝∫QdEEαS2πKFG(EQ)∫EdkkDθ(Ek;Eθ0,kθ)ΔN(q)(kθ),where).Analytically,itisrepresentedby\begin{equation}\Delta N^{(q)}\left(Q\theta_{0},\frac{\theta_{0}}{\theta}\right)\propto\int^{Q}\frac{dE}{E}\frac{\alpha_{S}}{2\pi}K_{F}^{G}\left(\frac{E}{Q}\right)\int^{E}\frac{dk}{k}D^{\theta}\left(\frac{E}{k};E\theta_{0},k\theta\right)\Delta N^{(q)}(k\theta),\end{equation}whereΔN^(q)≡F_q⟨n ⟩^qistheunnormalizedfactorialmoment(inthelefthandside,forthewholejet,andintherighthandside,forthepartonsubjetwithmomentumfragmentsistheunnormalizedfactorialmoment(inthelefthandside,forthewholejet,andintherighthandside,forthepartonsubjetwithmomentumistheunnormalizedfactorialmoment(intheleft-handside,forthewholejet,andintheright-handside,forthepartonsubjetwithmomentumkhittingthebinfragmentshittingthebinhittingthebinθ).Sincetheunnormalizedmomentsincreasewithenergywhilethepartonspectrumdecreases,theproductfragments).Sincetheunnormalizedmomentsincreasewithenergywhilethepartonspectrumdecreases,theproduct).Sincetheunnormalizedmomentsincreasewithenergywhilethepartonspectrumdecreases,theproductD^θΔN^(q)(kθ)hasamaximumatsomeenergy,andtheintegralovermomentamaybecalculatedbythesteepestdescentmethod.Leavingasidethedetailsofcalculations(see[38]),wedescribethegeneralstructureofthecorrelatorforthefixedcouplingconstantfragmentshasamaximumatsomeenergy,andtheintegralovermomentamaybecalculatedbythesteepestdescentmethod.Leavingasidethedetailsofcalculations(see[38]),wedescribethegeneralstructureofthecorrelatorforthefixedcouplingconstanthasamaximumatsomeenergy,andtheintegralovermomentamaybecalculatedbythesteepestdescentmethod.Leavingasidethedetailsofcalculations(see\cite[cite]{[\@@bibref{}{38}{}{}]}),wedescribethegeneralstructureofthecorrelatorforthefixedcouplingconstantγ_0 = \const:(37)37ΔN(q)∝ΔΩ(θ0θ)γ0q(Eθc)qγ0,(c=\const),wherethethreefactorsrepresentthephasespace,theenergyspectrumfactorandthefragments:(37)37ΔN(q)∝ΔΩ(θ0θ)γ0q(Eθc)qγ0,(c=\const),wherethethreefactorsrepresentthephasespace,theenergyspectrumfactorandthe:\begin{equation}\Delta N^{(q)}\propto\Delta\Omega\left(\frac{\theta_{0}}{\theta}\right)^{\frac{\gamma_{0}}{q}}\left(\frac{E\theta}{c}\right)^{q\gamma_{0}},\;\;\;\;\;\;(c=\const),\end{equation}wherethethreefactorsrepresentthephasespace,theenergyspectrumfactorandtheqthpoweroftheaveragemultiplicity.Togetthenormalizedmoment,oneshoulddivide(37)bythefragmentsthpoweroftheaveragemultiplicity.Togetthenormalizedmoment,oneshoulddivide(37)bythe-thpoweroftheaveragemultiplicity.Togetthenormalizedmoment,oneshoulddivide(\ref{102})bytheqthpowerofthatpartofthemeanmultiplicityofthewholejetwhichappearsinsidethewindowfragmentsthpowerofthatpartofthemeanmultiplicityofthewholejetwhichappearsinsidethewindow-thpowerofthatpartofthemeanmultiplicityofthewholejetwhichappearsinsidethewindowθi.e.bytheshareofthetotalaveragemultiplicitycorrespondingtothephasespacevolumefragmentsi.e.bytheshareofthetotalaveragemultiplicitycorrespondingtothephasespacevolumei.e.bytheshareofthetotalaveragemultiplicitycorrespondingtothephasespacevolumeΔΩ:(38)38ΔN(θ)∼ΔΩΔN(θ0).Iftheanalysishasbeendoneinthefragments:(38)38ΔN(θ)∼ΔΩΔN(θ0).Iftheanalysishasbeendoneinthe:\begin{equation}\Delta N(\theta)\sim\Delta\Omega\Delta N(\theta_{0}).\end{equation}IftheanalysishasbeendoneintheDdimensionalspace,thephasespacevolumeisproportionalto:(39)39ΔΩ∼θD,wherefragmentsdimensionalspace,thephasespacevolumeisproportionalto:(39)39ΔΩ∼θD,where-dimensionalspace,thephasespacevolumeisproportionalto:\begin{equation}\Delta\Omega\sim\theta^{D},\end{equation}whereθcorrespondstotheminimallinearsizeonthefragmentscorrespondstotheminimallinearsizeonthecorrespondstotheminimallinearsizeontheDdimensionalwindowthatstemsfromthesingularbehaviourofpartonpropagatorsinquantumchromodynamics(see[38]).Thatiswhythefactorialmomentsmayberepresentedasproductsofthepurelykinematicalfactordependingonthedimensionoftheanalyzedspace,andofthedynamicalfactor,whichisnotrelatedtothedimensionanddefinedbythecouplingconstant(40)40Fq∼θ-D(q-1)θq2-1qγ0.Atsmallangularwindowsonegetsfragmentsdimensionalwindowthatstemsfromthesingularbehaviourofpartonpropagatorsinquantumchromodynamics(see[38]).Thatiswhythefactorialmomentsmayberepresentedasproductsofthepurelykinematicalfactordependingonthedimensionoftheanalyzedspace,andofthedynamicalfactor,whichisnotrelatedtothedimensionanddefinedbythecouplingconstant(40)40Fq∼θ-D(q-1)θq2-1qγ0.Atsmallangularwindowsonegets-dimensionalwindowthatstemsfromthesingularbehaviourofpartonpropagatorsinquantumchromodynamics(see\cite[cite]{[\@@bibref{}{38}{}{}]}).Thatiswhythefactorialmomentsmayberepresentedasproductsofthepurelykinematicalfactordependingonthedimensionoftheanalyzedspace,andofthedynamicalfactor,whichisnotrelatedtothedimensionanddefinedbythecouplingconstant\begin{equation}F_{q}\sim\theta^{-D(q-1)}\theta^{\frac{q^{2}-1}{q}\gamma_{0}}.\end{equation}Atsmallangularwindowsonegetsθδyandtheintermittencyindicesdefinedbyeq.(LABEL:100)are(41)41ϕ(q)=D(q-1)-q2-1qγ0.Theformula(41)isvalidformoderatelysmallbinswhentheconditionfragmentsandtheintermittencyindicesdefinedbyeq.(LABEL:100)are(41)41ϕ(q)=D(q-1)-q2-1qγ0.Theformula(41)isvalidformoderatelysmallbinswhentheconditionandtheintermittencyindicesdefinedbyeq.(\ref{100})are\begin{equation}\phi(q)=D(q-1)-\frac{q^{2}-1}{q}\gamma_{0}.\end{equation}Theformula(\ref{106})isvalidformoderatelysmallbinswhentheconditionα_Slnθ_0/θ¡1isfulfilled.Forextremelysmallwindows,oneshouldtakeintoaccountthatthecouplingconstantisrunning.Thentheconstantfragmentsisfulfilled.Forextremelysmallwindows,oneshouldtakeintoaccountthatthecouplingconstantisrunning.Thentheconstantisfulfilled.Forextremelysmallwindows,oneshouldtakeintoaccountthatthecouplingconstantisrunning.Thentheconstantγ_0shouldbereplacedbytheeffectivevaluefragmentsshouldbereplacedbytheeffectivevalueshouldbereplacedbytheeffectivevalueγ,whichdependslogarithmicallyonthewidthofthewindowfragments,whichdependslogarithmicallyonthewidthofthewindow,whichdependslogarithmicallyonthewidthofthewindowθandmaybeapproximatedby[38]
γ=γ0(1+ϵ4), (42)
where(43)43ϵ=q2+1q2lnθ0/θln(Eθ0/μ≤1.Asaresult,numericalvaluesoftheintermittencyindicesforverysmallbinsbecomenoticeablysmallerthaninthefixedcouplingregime,especiallyforthelowrankmoments.Moreover,thesimplepowerlawbehaviour(LABEL:100)becomesmodifiedbythelogarithmiccorrectiontermsandtheintermittencyindicesdependonthevalueoftheintervalchosen.Theresultingcurveof
fragmentsandmaybeapproximatedby[38]
γ=γ0(1+ϵ4), (42)
where(43)43ϵ=q2+1q2lnθ0/θln(Eθ0/μ≤1.Asaresult,numericalvaluesoftheintermittencyindicesforverysmallbinsbecomenoticeablysmallerthaninthefixedcouplingregime,especiallyforthelowrankmoments.Moreover,thesimplepowerlawbehaviour(LABEL:100)becomesmodifiedbythelogarithmiccorrectiontermsandtheintermittencyindicesdependonthevalueoftheintervalchosen.Theresultingcurveof
andmaybeapproximatedby\cite[cite]{[\@@bibref{}{38}{}{}]}\begin{equation}\langle\gamma\rangle=\gamma_{0}(1+\frac{\epsilon}{4}),\end{equation}where\begin{equation}\epsilon=\frac{q^{2}+1}{q^{2}}\frac{\ln\theta_{0}/\theta}{\ln(E\theta_{0}/\mu}\leq 1.\end{equation}Asaresult,numericalvaluesoftheintermittencyindicesforverysmallbinsbecomenoticeablysmallerthaninthefixedcouplingregime,especiallyforthelow-rankmoments.Moreover,thesimplepower-lawbehaviour(\ref{100})becomesmodifiedbythelogarithmiccorrectiontermsandtheintermittencyindicesdependonthevalueoftheintervalchosen.Theresultingcurveof
lnF_qasafunctionoffragmentsasafunctionofasafunctionof-lnθhastwobranches.Therathersteeplinearincreaseatthemoderatelysmallwindowsfragmentshastwobranches.Therathersteeplinearincreaseatthemoderatelysmallwindowshastwobranches.Therathersteeplinearincreaseatthemoderatelysmallwindowsθwiththeslope(41)isreplacedatsmallerbinsizesbymuchslowerquasilinearincreasegivenby(42),(43).Itiseasytocalculatethepositionofthetransitionpointtoanotherregimeandshowthatathighervaluesoffragmentswiththeslope(41)isreplacedatsmallerbinsizesbymuchslowerquasilinearincreasegivenby(42),(43).Itiseasytocalculatethepositionofthetransitionpointtoanotherregimeandshowthatathighervaluesofwiththeslope(\ref{106})isreplacedatsmallerbinsizesbymuchslowerquasi-linearincreasegivenby(\ref{107}),(\ref{108}).Itiseasytocalculatethepositionofthetransitionpointtoanotherregimeandshowthatathighervaluesofqthatpointshiftstosmallerbinsizes.Still,thefactorialmomentsofanyrankincreaseatsmallerintervals.Itdemonstratesthatthecorrespondingfluctuationsofthemultiplicitydistributionsbecomestrongerthanthoseinlargerintervalsand,whatisimportant,exceednoticeablythePoissonfluctuations.Wehavedescribedtheresultsofthedoublelogarithmicapproximation.Thecorrectionsduetothemodifiedleadinglogarithmtermsarecomparativelysmallnumerically(about10percents).Forexample,theymovethetransitionpoint(frompowerlawtoquasipowerregime)toslightlysmallerbinsforanymomentexceptofthesecondonewhereitmovestosomewhatlargerangles.Thistendencycanbeeasilyprescribedtothemutualinfluenceoftheenergyspectrumandtheaveragemultiplicity.Ofmoreimportancearethequalitativeeffectsofnewfunctionaldependenceontherankfragmentsthatpointshiftstosmallerbinsizes.Still,thefactorialmomentsofanyrankincreaseatsmallerintervals.Itdemonstratesthatthecorrespondingfluctuationsofthemultiplicitydistributionsbecomestrongerthanthoseinlargerintervalsand,whatisimportant,exceednoticeablythePoissonfluctuations.Wehavedescribedtheresultsofthedoublelogarithmicapproximation.Thecorrectionsduetothemodifiedleadinglogarithmtermsarecomparativelysmallnumerically(about10percents).Forexample,theymovethetransitionpoint(frompowerlawtoquasipowerregime)toslightlysmallerbinsforanymomentexceptofthesecondonewhereitmovestosomewhatlargerangles.Thistendencycanbeeasilyprescribedtothemutualinfluenceoftheenergyspectrumandtheaveragemultiplicity.Ofmoreimportancearethequalitativeeffectsofnewfunctionaldependenceontherankthatpointshiftstosmallerbinsizes.Still,thefactorialmomentsofanyrankincreaseatsmallerintervals.Itdemonstratesthatthecorrespondingfluctuationsofthemultiplicitydistributionsbecomestrongerthanthoseinlargerintervalsand,whatisimportant,exceednoticeablythePoissonfluctuations.\par Wehavedescribedtheresultsofthedoublelogarithmicapproximation.Thecorrectionsduetothemodifiedleadinglogarithmtermsarecomparativelysmallnumerically(about10percents).Forexample,theymovethetransitionpoint(frompower-lawtoquasipowerregime)toslightlysmallerbinsforanymomentexceptofthesecondonewhereitmovestosomewhatlargerangles.Thistendencycanbeeasilyprescribedtothemutualinfluenceoftheenergyspectrumandtheaveragemultiplicity.Ofmoreimportancearethequalitativeeffectsofnewfunctionaldependenceontherankqduetothetermsproportionaltofragmentsduetothetermsproportionaltoduetothetermsproportionaltoqγ.Forexample,theattempttoexploittheanalogytostatisticalmechanics[38],wherethequantityfragments.Forexample,theattempttoexploittheanalogytostatisticalmechanics[38],wherethequantity.Forexample,theattempttoexploittheanalogytostatisticalmechanics\cite[cite]{[\@@bibref{}{38}{}{}]},wherethequantity1-ϕ(q)+1qisinterpretedas"freeenergy"andtherankfragmentsisinterpretedas"freeenergy"andtherankisinterpretedas"freeenergy"andtherankqasaninversetemperaturefragmentsasaninversetemperatureasaninversetemperatureβ=1/kT,hasledtotheunexpectedresultaboutthe"phasetransition".Itshowsupbecausethe"freeenergy"increasesmonotonicallywithfragments,hasledtotheunexpectedresultaboutthe"phasetransition".Itshowsupbecausethe"freeenergy"increasesmonotonicallywith,hasledtotheunexpectedresultaboutthe"phasetransition".Itshowsupbecausethe"freeenergy"increasesmonotonicallywithqinthelowestorderapproximationwhilehigherordercorrectionsgiverisetothemaximumjustatthosefragmentsinthelowestorderapproximationwhilehigherordercorrectionsgiverisetothemaximumjustatthoseinthelowestorderapproximationwhilehigherordercorrectionsgiverisetothemaximumjustatthoseqvalueswherefragmentsvalueswherevalueswhereH_qhasaminimum(LABEL:71)describedabovei.e.at(44)44qcr≈IamverymuchindebtedtoYu.L.Dokshitzer,G.Gianini,R.C.Hwa,B.B.LevtchenkoandV.A.NechitailowithwhomIcollaboratedonthesubject.ThisworkwassupportedbyRussianFundforFundamentalStudies(grant93023815)andbyInternationalScienceFoundation(grantM5V000).𝐅𝐢𝐠𝐮𝐫𝐞𝐂𝐚𝐩𝐭𝐢𝐨𝐧𝐬Fig.1Fractionalfactorialmoments[15]ofPoisson(e)andnegativebinomialdistributions(adcorrespondtovariousvaluesoffragmentshasaminimum(LABEL:71)describedabovei.e.at(44)44qcr≈IamverymuchindebtedtoYu.L.Dokshitzer,G.Gianini,R.C.Hwa,B.B.LevtchenkoandV.A.NechitailowithwhomIcollaboratedonthesubject.ThisworkwassupportedbyRussianFundforFundamentalStudies(grant93023815)andbyInternationalScienceFoundation(grantM5V000).FigureCaptionsFig.1Fractionalfactorialmoments[15]ofPoisson(e)andnegativebinomialdistributions(adcorrespondtovariousvaluesofhasaminimum(\ref{71})describedabovei.e.at\begin{equation}q_{cr}\approx\frac{1}{h_{1}\gamma_{0}\approx 5.\end{equation}}\vspace{2mm}\par IamverymuchindebtedtoYu.L.Dokshitzer,G.Gianini,R.C.Hwa,B.B.LevtchenkoandV.A.NechitailowithwhomIcollaboratedonthesubject.\par ThisworkwassupportedbyRussianFundforFundamentalStudies(grant93-02-3815)andbyInternationalScienceFoundation(grantM5V000).\par{\bf FigureCaptions}\par Fig.1Fractionalfactorialmoments[15]ofPoisson(e)andnegativebinomialdistributions(a-dcorrespondtovariousvaluesofk)withtheaveragemultiplicityfragments)withtheaveragemultiplicity)withtheaveragemultiplicity⟨n ⟩=2.Theamplitudeofoscillationsdecreasesstronglyatlargerfragments2.Theamplitudeofoscillationsdecreasesstronglyatlarger=2.Theamplitudeofoscillationsdecreasesstronglyatlarger⟨n ⟩andsmallerfragmentsandsmallerandsmallerk.Fig.2Momentsofthenegativebinomialdistribution[21]forfragments.Fig.2Momentsofthenegativebinomialdistribution[21]for.\par Fig.2Momentsofthenegativebinomialdistribution[21]fork=5and10calculatedforintegervaluesoffragments5and10calculatedforintegervaluesof=5and10calculatedforintegervaluesofq.Thecurvesaredrawntoguidetheeye.(a)fragments.Thecurvesaredrawntoguidetheeye.(a).Thecurvesaredrawntoguidetheeye.\\ (a)lnF_q,(b)fragments,(b),(b)lnK_q,(c)fragments,(c),(c)lnH_q.Fig.3Momentsoffixedmultiplicitydistribution[21]forfragments.Fig.3Momentsoffixedmultiplicitydistribution[21]for.\par Fig.3Momentsoffixedmultiplicitydistribution[21]forn_0=10calculatedforintegervaluesoffragments10calculatedforintegervaluesof=10calculatedforintegervaluesofq.Thecurvesaredrawntoguidetheeye.(a)fragments.Thecurvesaredrawntoguidetheeye.(a).Thecurvesaredrawntoguidetheeye.\\ (a)F_q,(b)fragments,(b),(b)K_q,ln—K_q—,(c)fragments,(c),(c)H_q,ln—H_q—.Fig.4(a)Theratiooffactorialmomentsasderivedfromeq.(LABEL:58)totheasymptoticalvaluesofeq.(LABEL:59)(theinset)andthesimilarratioasderivedfromtheKNOcurve(seeFig.5)andeq.(LABEL:59)(themainpart).(b)Theratiofragments.Fig.4(a)Theratiooffactorialmomentsasderivedfromeq.(LABEL:58)totheasymptoticalvaluesofeq.(LABEL:59)(theinset)andthesimilarratioasderivedfromtheKNOcurve(seeFig.5)andeq.(LABEL:59)(themainpart).(b)Theratio.\par Fig.4(a)Theratiooffactorialmomentsasderivedfromeq.(\ref{58})totheasymptoticalvaluesofeq.(\ref{59})(theinset)andthesimilarratioasderivedfromtheKNO--curve(seeFig.5)andeq.(\ref{59})(themainpart).\\ (b)TheratioH_qobtainedfromtheKNOcurve(seeFig.5)(thesolidline)ascomparedtoitsNBDcounterpartforfragmentsobtainedfromtheKNOcurve(seeFig.5)(thesolidline)ascomparedtoitsNBDcounterpartforobtainedfromtheKNO--curve(seeFig.5)(thesolidline)ascomparedtoitsNBD-counterpartfork=7(thedashedline).IamindebtedtoB.B.LevtchenkowhoprovidedthisFigurespeciallyforthereview.Fig.5ThemodifiedKNOfunction[12](solidcurve)forfragments7(thedashedline).IamindebtedtoB.B.LevtchenkowhoprovidedthisFigurespeciallyforthereview.Fig.5ThemodifiedKNOfunction[12](solidcurve)for=7(thedashedline).\\ IamindebtedtoB.B.LevtchenkowhoprovidedthisFigurespeciallyforthereview.\par Fig.5ThemodifiedKNO--function[12](solidcurve)forγ=0.4ismuchnarrowerthanthelowestorderdistribution(thedashedline).Thenegativebinomialdistributionwithfragments0.4ismuchnarrowerthanthelowestorderdistribution(thedashedline).Thenegativebinomialdistributionwith=0.4ismuchnarrowerthanthelowestorderdistribution(thedashedline).Thenegativebinomialdistributionwithk=7isalsoshownforcomparison(dots).Fig.6Theratiofragments7isalsoshownforcomparison(dots).Fig.6Theratio=7isalsoshownforcomparison(dots).\par Fig.6TheratioH_qasafunctionoffragmentsasafunctionofasafunctionofq[39]reveals"quasioscillations"inhigherorderperturbativeQCD(thecurveisdrawnforenergiesoffragments[39]reveals"quasioscillations"inhigherorderperturbativeQCD(thecurveisdrawnforenergiesof[39]reveals"quasi-oscillations"inhigherorderperturbativeQCD(thecurveisdrawnforenergiesofZ^0).Thefirstminimumisslightlyshifted(comparedtogluodynamics)tofragments).Thefirstminimumisslightlyshifted(comparedtogluodynamics)to).Thefirstminimumisslightlyshifted(comparedtogluodynamics)toq=4.Fig.7fragments4.Fig.7=4.\par Fig.7Qdependenceoftheanomalousdimensionfragmentsdependenceoftheanomalousdimension-dependenceoftheanomalousdimensionγ[41](solidlines)incaseoftherunningcouplingfragments[41](solidlines)incaseoftherunningcoupling[41](solidlines)incaseoftherunningcouplingγ_0(dashedlines)fordifferentnumber(shownnearthelines)ofactiveflavours.Fig.8fragments(dashedlines)fordifferentnumber(shownnearthelines)ofactiveflavours.Fig.8(dashedlines)fordifferentnumber(shownnearthelines)ofactiveflavours.\par Fig.8ydependenceoftheaveragemultiplicityforrunning(solidlines)andfixed(dashedlines)coupling[41]withthenumberofactiveflavoursfragmentsdependenceoftheaveragemultiplicityforrunning(solidlines)andfixed(dashedlines)coupling[41]withthenumberofactiveflavours-dependenceoftheaveragemultiplicityforrunning(solidlines)andfixed(dashedlines)coupling[41]withthenumberofactiveflavoursn_f=3,4,5.Thearrowmarksthefragments3,4,5.Thearrowmarksthe=3,4,5.Thearrowmarksthey_Z^0location.Fig.9fragmentslocation.Fig.9location.\par Fig.9γvsfragmentsvsvsγ_0forfragmentsforforn_f=3,4,5[42].Fig.10fragments3,4,5[42].Fig.10=3,4,5[42].\par Fig.10rvsfragmentsvsvsγ_0forfragmentsforforn_f=3,4,5[42].Fig.11fragments3,4,5[42].Fig.11=3,4,5[42].\par Fig.11γvsfragmentsvsvslnQforfragmentsforforn_f=3,4,5andfragments3,4,5and=3,4,5andQ=M_Z/m [42]   (m=1,2,4,8).Fig.12MomentsofmultiplicitydistributioninfixedcouplingQCDforfragments.Fig.12MomentsofmultiplicitydistributioninfixedcouplingQCDfor.\par Fig.12Momentsofmultiplicitydistributioninfixed-couplingQCDforγ_0=0.48,fragments0.48,=0.48,n_f=5[21].(a)fragments5[21].(a)=5[21].\;\;(a)lnF_q , lnΦ_q,(b)fragments,(b),(b)ln—K_q—, ln—Ψ_q—.Fig.13Ratiofragments.Fig.13Ratio.\par Fig.13RatioH_qofgluonjetdistributioninfixedcouplingQCDforfragmentsofgluonjetdistributioninfixedcouplingQCDforofgluon-jetdistributioninfixed-couplingQCDforγ_0=0.48,fragments0.48,=0.48,n_f=5[21].(a)fragments5[21].(a)=5[21].\;\;(a)H_q,(b)fragments,(b),(b)ln—H_q—.Fig.14Ratiofragments.Fig.14Ratio.\par Fig.14Ratioη_qofquarkjetdistributioninfixedcouplingQCDforfragmentsofquarkjetdistributioninfixedcouplingQCDforofquark-jetdistributioninfixed-couplingQCDforγ_0=0.48,fragments0.48,=0.48,n_f=5[21].(a)fragments5[21].(a)=5[21].\;\;(a)η_q,(b)fragments,(b),(b)ln—η_q —.Fig.15Ratiofragments.Fig.15Ratio.\par Fig.15Ratiorofaveragemultiplicitiesingluonandquarkjets[48].Analyticresultsareshownbyuppercurves.TheresultsobtainedfromtheHerwigMonteCarloatthepartonandhadronlevelsarealsoshown.Fig.16fragmentsofaveragemultiplicitiesingluonandquarkjets[48].Analyticresultsareshownbyuppercurves.TheresultsobtainedfromtheHerwigMonteCarloatthepartonandhadronlevelsarealsoshown.Fig.16ofaveragemultiplicitiesingluonandquarkjets[48].\\ Analyticresultsareshownbyuppercurves.TheresultsobtainedfromtheHerwigMonteCarloatthepartonandhadronlevelsarealsoshown.\par Fig.16H_qvsfragmentsvsvsqinfragmentsinine^+e^-dataofDELPHIcollaborationat91GeV[51].Fig.17fragmentsdataofDELPHIcollaborationat91GeV[51].Fig.17dataofDELPHIcollaborationat91GeV[51].\par Fig.17H_qvsfragmentsvsvsqinfragmentsininp¯pdataofUA5collaborationat546GeV[51].Fig.18fragmentsdataofUA5collaborationat546GeV[51].Fig.18dataofUA5collaborationat546GeV[51].\par Fig.18H_qvsfragmentsvsvsqinfragmentsinine^+e^-datainawideenergyinterval[51](experimentalgroupsareorderedasinTable2,i.e.theenergyincreasesfromtoptobottom).Ontheleftthelowestordersareshowninthelogscale,ontherightthehigherordersinthelinearscale.Fig.19fragmentsdatainawideenergyinterval[51](experimentalgroupsareorderedasinTable2,i.e.theenergyincreasesfromtoptobottom).Ontheleftthelowestordersareshowninthelogscale,ontherightthehigherordersinthelinearscale.Fig.19datainawideenergyinterval[51](experimentalgroupsareorderedasinTable2,i.e.theenergyincreasesfromtoptobottom).Ontheleftthelowestordersareshowninthelogscale,ontherightthehigherordersinthelinearscale.\par Fig.19H_qvsfragmentsvsvsqinfragmentsininpp(andfragments(and(and¯pdatainawideenergyinterval[51](thecommentsarethesameasinFig.18).Fig.20Emissionofthegluon(wavylines)jetbythequark(thesolidline)[38].References[1]1I.V.Andreev,Chromodynamicsandhardprocessesathighenergies,Moscow,Nauka,1981(inRussian).[2]2B.L.Ioffe,L.N.LipatovandV.A.Khoze,Deepinelasticprocesses,Moscow,Energoatomizdat,1983(inRussian).[3]3F.J.Yndurain,Quantumchromodynamics,N.Y.BerlinHeidelbergTokyo,SpringerVerlag,1983.[4]4M.B.VoloshinandK.A.TerMartirosyan,Theoryofgaugeinteractionsofelementaryparticles,Moscow,Energoatomizdat,1984(inRussian).[5]5Yu.L.Dokshitzer,V.A.Khoze,A.H.MuellerandS.I.Troyan,BasicsofperturbativeQCD,GifsurYvette,EditionsFrontieres,1991.[6]6AGiovanniniandLVanHove,Z.Phys.C30(1986)391;ActaPhys.Pol.B19(1988)495;917;931.[7]7Z.Koba,H.B.NielsenandP.Olesen,Nucl.Phys.B40(1972)317.[8]8Ya.I.Azimov,Yu.L.Dokshitzer,V.A.KhozeandS.I.Troyan,Z.Phys.C27(1985)65.[9]9D.AmatiandG.Veneziano,Phys.Lett.B83(1979)87.[10]10A.Bassetto,M.CiafaloniandG.Marchesini,Phys.Rep.C100(1983)201.fragmentsdatainawideenergyinterval[51](thecommentsarethesameasinFig.18).Fig.20Emissionofthegluon(wavylines)jetbythequark(thesolidline)[38].References[1]1I.V.Andreev,Chromodynamicsandhardprocessesathighenergies,Moscow,Nauka,1981(inRussian).[2]2B.L.Ioffe,L.N.LipatovandV.A.Khoze,Deepinelasticprocesses,Moscow,Energoatomizdat,1983(inRussian).[3]3F.J.Yndurain,Quantumchromodynamics,N.Y.BerlinHeidelbergTokyo,SpringerVerlag,1983.[4]4M.B.VoloshinandK.A.TerMartirosyan,Theoryofgaugeinteractionsofelementaryparticles,Moscow,Energoatomizdat,1984(inRussian).[5]5Yu.L.Dokshitzer,V.A.Khoze,A.H.MuellerandS.I.Troyan,BasicsofperturbativeQCD,GifsurYvette,EditionsFrontieres,1991.[6]6AGiovanniniandLVanHove,Z.Phys.C30(1986)391;ActaPhys.Pol.B19(1988)495;917;931.[7]7Z.Koba,H.B.NielsenandP.Olesen,Nucl.Phys.B40(1972)317.[8]8Ya.I.Azimov,Yu.L.Dokshitzer,V.A.KhozeandS.I.Troyan,Z.Phys.C27(1985)65.[9]9D.AmatiandG.Veneziano,Phys.Lett.B83(1979)87.[10]10A.Bassetto,M.CiafaloniandG.Marchesini,Phys.Rep.C100(1983)201.

Conversion to HTML had a Fatal error and exited abruptly. This document may be truncated or damaged.