“twelveit

Lunar Occultation of MACHOs

“twelvebfCheongho Han

“twelvebfVijay K. Narayanan

“twelvebfAndrew Gould1

“tenity𝑦{\mathchar 633\relax}1 Alfred P. Sloan Foundation Fellow

Dept. of Astronomy, The Ohio State University, Columbus, OH 43210

e-mail cheongho@payne.mps.ohio-state.edu

e-mail vijay@payne.mps.ohio-state.edu

e-mail gould@payne.mps.ohio-state.edu

“twelvebfAbstract

Lunar occultation can be used to measure the proper motions of some of the long time scale microlensing events, te>70fragmentsfragmentssimilar-tosubscript𝑡𝑒70t_{e}\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}70 days, now being detected toward the Galactic bulge. The long events are difficult to explain within the context of standard models of the mass distribution and dynamics of the Galaxy. Han & Gould (1995b) have suggested that they may be due to a kinematically cold population near the Sun. To resolve the mass, distance, and velocity of individual events and so to determine their nature, one must measure parallaxes and proper motions. For long events, parallaxes can be often obtained from ground-based measurements, but proper motions can only rarely be determined using conventional methods. Lunar occultations are therefore key to the understanding of the long events. We carry out realistic simulations to estimate the uncertainty of these measurements and show that proper motions could be measured for about one long event per year.


“fourteenit“fourteenbf1.  Introduction

The MACHO (Alcock et al. 1995; Bennett et al. 1995) and OGLE (Udalski et al. 1994) collaborations have reported 54 candidate lensing events toward the Galactic bulge caused by Massive Compact Objects (MACHOs). The current estimate of the optical depth obtained by both groups is significantly higher than the theoretical estimate (Griest et al. 1991). Various solutions have been proposed to explain the observed optical depth excess. One solution assumes a bar-shaped Galactic bulge (Kiraga & Pacyński 1994; Zhao, Spergel, & Rich 1994). However, the excess optical depth is not completely solved even with the adoption of a triaxial bulge (Han & Gould 1995a).

Recently, Han & Gould (1995b) argued that the long events, those with time scales of te>70\twelveitdaysfragmentsfragmentssimilar-tosubscript𝑡𝑒70\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑑𝑎𝑦𝑠t_{e}\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}70\ {\twelveitdays}, cannot be explained within the context of the standard models of the mass distribution and stellar dynamics of the Galaxy, leaving the origin of these events as a puzzle. Although only three of the reported 54 events observed belong to this group, these long events contribute a significant fraction to the optical depth, provided that they are truly caused by MACHOs. Hence, their potential importance far exceeds their number. Han & Gould (1995b) proposed that long events might be caused by a dynamically cold population of dark objects such as black holes or neutron stars. Being dynamically cold, such objects would be located very close to the Galactic plane, and thus only objects near the Sun could contribute to the events detected toward Baade’s window located at b=3.9𝑏superscript3.9b=-3^{\circ}\hskip-2.0pt.9. The objects would then have low transverse speeds and so long tesubscript𝑡𝑒t_{e}.

The time scale, tesubscript𝑡𝑒t_{e}, is the only observable from current observations, but from tesubscript𝑡𝑒t_{e} alone it is difficult to constrain the physical parameters of the long tesubscript𝑡𝑒t_{e} events. The time scale is related to the physical parameters by

te=rev;re2=4GMc2D\twelveitolD\twelveitlsD\twelveitos.formulae-sequencesubscript𝑡𝑒subscript𝑟𝑒𝑣superscriptsubscript𝑟𝑒24𝐺𝑀superscript𝑐2subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑙subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑙𝑠subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠t_{e}={r_{e}\over v};\ \ r_{e}^{2}={4GM\over c^{2}}{D_{\twelveitol}D_{\twelveitls}\over D_{\twelveitos}}. (1.1)1.1

Since there are three parameters, and only one measured quantity, the individual events are highly degenerate. Here resubscript𝑟𝑒r_{e} is the Einstein ring radius, M𝑀M is the MACHO mass, v𝑣v is its transverse speed relative to the observer-source line of sight, and D\twelveitolsubscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑙D_{\twelveitol}, D\twelveitossubscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠D_{\twelveitos}, and D\twelveitlssubscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑙𝑠D_{\twelveitls} are the distances between the observer, lens, and source.

There have been two general approaches to break the degeneracy of the physical parameters; parallax and proper motion measurements. If the parallax is measured one can obtain the projected speed v~~𝑣\tilde{v}:

v~=D\twelveitolD\twelveitlsv.~𝑣subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑙subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑙𝑠𝑣\tilde{v}={D_{\twelveitol}\over D_{\twelveitls}}v. (1.2)1.2

The proper motion, μ𝜇\mu, is determined by measuring the angular size of the Einstein ring, θesubscript𝜃𝑒\theta_{e}:

μ=θete;θereD\twelveitol.formulae-sequence𝜇subscript𝜃𝑒subscript𝑡𝑒subscript𝜃𝑒subscript𝑟𝑒subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑙\mu={\theta_{e}\over t_{e}};\ \ \theta_{e}\equiv{r_{e}\over D_{\twelveitol}}. (1.3)1.3

If both the proper motion and parallax of a MACHO are measured, one can obtain the distance to the MACHO by

D\twelveitol=D\twelveitos(μv~D\twelveitos+1)1,subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑙subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠superscript𝜇~𝑣subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠11D_{\twelveitol}=D_{\twelveitos}\left({\mu\over\tilde{v}}D_{\twelveitos}+1\right)^{-1}, (1.4)1.4

since the distance to the source stars D\twelveitos=8\twelveitkpcsubscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠8\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑘𝑝𝑐D_{\twelveitos}=8\ {\twelveitkpc} is known. Similarily M=(c2/4G)te2v~μ𝑀superscript𝑐24𝐺superscriptsubscript𝑡𝑒2~𝑣𝜇M=(c^{2}/4G)t_{e}^{2}\tilde{v}\mu and v1=v~1+(μD\twelveitos)1superscript𝑣1superscript~𝑣1superscript𝜇subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠1v^{-1}=\tilde{v}^{-1}+(\mu D_{\twelveitos})^{-1}. Therefore, the physical parameters of MACHOs would be uniquely determined from the combined information of parallax and proper motion.

For typical short events seen toward the bulge, parallax can be measured only from space (Gould 1994, 1995), and proper motions can be measured for only a few percent of events where the MACHO transits the face of the star (Gould 1994; Nemiroff & Wickramasinghe 1994; Witt 1995). However, parallax measurements for long-time-scale events become feasible from the ground while proper motion measurement with traditional techniques becomes essentially impossible. Ground based parallax measurements are possible because the Earth moves through a substantial fraction of the Einstein ring during the event. Indeed Bennett et al. (1995) measured a parallax for one of the three long events using only the routine monitoring data (i.e., no followup photometry). On the other hand, proper motions from transits are rare because θe>1\twelveitmasfragmentsfragmentssimilar-tosubscript𝜃𝑒1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\theta_{e}\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}1\ {\twelveitmas} while the angular source size θ<10\twelveitμasfragmentsfragmentssimilar-tosubscript𝜃10\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇𝑎𝑠\theta_{\star}\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}10\ {\twelveit\mu as}, even for giants. However, large θesubscript𝜃𝑒\theta_{e} opens a possibility of resolving the two images of a lensed star and measuring their angular separation, ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep}. Once ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} is measured, one can uniquely determine μ𝜇\mu (see §2). Due to the large θesubscript𝜃𝑒\theta_{e} of long events, it may one day be possible to measure ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} with high-resolution interferometry. Unfortunately, current interferometry has not achieved high enough resolution to resolve the expected very small separations of images; ϕ\twelveitsep3\twelveitmassimilar-tosubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝3\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\phi_{\twelveitsep}\sim 3\ {\twelveitmas} for long events (see §3.2). Instead of interferometry, one can measure ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} by using lunar occultation. We show in §5.2 one can only measure the angular separation along a certain direction. However, this uncertainty can often be resolved with information about the lens geometry provided by parallax measurements. Even when the information from parallax measurement is inadequate, two lunar occultation measurements can resolve the degeneracy. Hence, lunar occultation gives enough information to determine the proper motion and so M𝑀M, v𝑣v, and D\twelveitolsubscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑙D_{\twelveitol}.

In this paper we analyze the possibility of measuring the angular separation of images of a gravitationally-lensed star using the lunar occultation method and determine the uncertainty of the measurement by carrying out realistic simulations. We find that if the observation is carried out for bright, moderate-highly magnified Galactic bulge giant stars, one can measure ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} with an uncertainty \twelveslΔϕ\twelveitsep<1\twelveitmasfragmentsfragmentssimilar-to\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠{\twelvesl\Delta}\phi_{\twelveitsep}\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}1\ {\twelveitmas}. The observational strategy and the method to find the intrinsic angular separation from the measured separation normal to the Moon’s surface are discussed in §5.


“fourteenit“fourteenbf2.  Proper Motion From Angular Separation Measurement

The angular Einstein ring radius and therefore the proper motion of the long events can be measured if the angular separation of the two images of a lensed star is measured. The locations of the images of the star are the solution to the quadratic lens equation given by

θ\twelveitIθ\twelveitSθ\twelveitIθe2=0,subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐼subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑆subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐼superscriptsubscript𝜃𝑒20\theta_{\twelveitI}-\theta_{\twelveitS}\theta_{\twelveitI}-\theta_{e}^{2}=0, (2.1)2.1

where θ\twelveitIsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐼\theta_{\twelveitI} and θ\twelveitSsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑆\theta_{\twelveitS} are the image and source angle measured from the lens location. Then the angular separation of the two images is given by

ϕ\twelveitsep=|θI+θI|=(x2+4)1/2θe,subscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝subscript𝜃limit-from𝐼subscript𝜃limit-from𝐼superscriptsuperscript𝑥2412subscript𝜃𝑒\phi_{\twelveitsep}=\left|\theta_{I+}-\theta_{I-}\right|=(x^{2}+4)^{1/2}\theta_{e}, (2.2)2.2

where the dimensionless parameter x𝑥x is the separation between the source and lens measured in units of θesubscript𝜃𝑒\theta_{e}: xθ\twelveitS/θe𝑥subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑆subscript𝜃𝑒x\equiv\theta_{\twelveitS}/\theta_{e}. The value of x𝑥x is uniquely determined from the light curve because the magnification of the lensed star is related to x𝑥x by A(x)=(x2+2)/x(x2+4)1/2𝐴𝑥superscript𝑥22𝑥superscriptsuperscript𝑥2412A(x)=(x^{2}+2)/x(x^{2}+4)^{1/2}. Thus, once the angular separation between two images of the source star is determined, one can obtain θesubscript𝜃𝑒\theta_{e}.


“fourteenit“fourteenbf3.  Diffraction Pattern by Lunar Occultation

“twelveit3.1  “twelvecpFresnel Diffraction

A stellar image produces a Fresnel diffraction pattern when it is occulted by the Moon. In this case, the star is idealized as a point source and the Moon’s disk as a semi-infinite plane. When images of a lensed star are blocked by the Moon, the observed diffraction pattern will differ slightly from a perfect point-source pattern because the image of the lensed star is composed of two images with a small separation. By carefully analyzing the occultation of a lensed star, one can use this difference to measure the angular separation which cannot be resolved using current telescope technology. Fortunately, the Moon passes through the Galactic bulge every month and this permits one to apply the lunar occultation method to measure the separation of two images of a star lensed by a significant fraction of MACHOs. In addition, since very long events are suspected to be caused by MACHOs close to the Sun, the angular separations would be large enough to measure ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} precisely by the lunar occultation method.

The diffraction pattern produced by a background source star when it is occulted by an opaque object (e.g., the Moon) is given by

gg0=12{[12\twelvebfC(z)]2+[12\twelvebfS(z)]2},𝑔subscript𝑔012superscriptdelimited-[]12\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝐶𝑧2superscriptdelimited-[]12\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝑆𝑧2{g\over g_{0}}={1\over 2}\left\{\left[{1\over 2}-{\twelvebfC}(z)\right]^{2}+\left[{1\over 2}-{\twelvebfS}(z)\right]^{2}\right\}, (3.1.1)3.1.1

where \twelvebfC\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝐶{\twelvebfC} and \twelvebfS\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝑆{\twelvebfS} are the Fresnel cosine and sine integrals and g0subscript𝑔0g_{0} is the intensity without diffraction (e.g., Hecht & Zajac 1979). The two Fresnel integrals are defined by

\twelvebfC(z)=\int0zcos(π2z2)dz,\twelvebfS(z)=\int0zsin(π2z2)dz.formulae-sequence\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝐶𝑧superscriptsubscript\int0𝑧𝜋2superscript𝑧2𝑑superscript𝑧\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝑆𝑧superscriptsubscript\int0𝑧𝜋2superscript𝑧2𝑑superscript𝑧{\twelvebfC}(z)=\int_{0}^{z}\cos\left({\pi\over 2}z^{\prime 2}\right)dz^{\prime},\ \ \ {\twelvebfS}(z)=\int_{0}^{z}\sin\left({\pi\over 2}z^{\prime 2}\right)dz^{\prime}. (3.1.2)3.1.2

Here the dimensionless distance variable z𝑧z is defined by

z=r[2(d\twelveitOM+d\twelveitM)λd\twelveitOMd\twelveitM]1/2,𝑧𝑟superscriptdelimited-[]2subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑂𝑀subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀𝜆subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑂𝑀subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀12z=r\left[{2(d_{\twelveitOM}+d_{\twelveitM})\over\lambda d_{\twelveitOM}d_{\twelveitM}}\right]^{1/2}, (3.1.3)3.1.3

where λ𝜆\lambda is the wavelength of the observation, d\twelveitMsubscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀d_{\twelveitM} and d\twelveitOM=D\twelveitosd\twelveitMsubscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑂𝑀subscript𝐷\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑜𝑠subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀d_{\twelveitOM}=D_{\twelveitos}-d_{\twelveitM} are the distance to the Moon from the Earth and from the source star, and r=d\twelveitMθ𝑟subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀𝜃r=d_{\twelveitM}\theta. Since d\twelveitOMd\twelveitMmuch-greater-thansubscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑂𝑀subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀d_{\twelveitOM}\gg d_{\twelveitM}, one can approximate eq. (3.1.3) by z=r(2/λd\twelveitM)1/2𝑧𝑟superscript2𝜆subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀12z=r(2/\lambda d_{\twelveitM})^{1/2}. When the image of a star is directly on the edge of the Moon’s surface, v=r=0𝑣𝑟0v=r=0, \twelvebfC(0)=\twelvebfS(0)=0\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝐶0\𝑡𝑤𝑒𝑙𝑣𝑒𝑏𝑓𝑆00{\twelvebfC}(0)={\twelvebfS}(0)=0 and g/g0=0.25𝑔subscript𝑔00.25g/g_{0}=0.25.

“twelveit3.2  “twelvecpSimulation

In our simulation the observations are assumed to be carried out as follows. During an occultation event, photometry is carried out continuously (i.e., with time resolution 1\twelveitmasmuch-less-thanabsent1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\ll 1\ {\twelveitmas}) and read instantaneously. This kind of high speed photometry technique has already been developed and the actual instrument (HSP) had been installed at the Hubble Space Telescope (HST) although the instrument was removed from HST to accommodate the installation of corrective optics. A large (>4\twelveitmfragmentsfragmentssimilar-toabsent4\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}4\ {\twelveitm}) telescope is required for the measurement to compensate for the relative faintness of even giant sources in the bulge. For an H=0𝐻0H=0 star, a (single channel) photometer can detect 9.4×109η\twelveslΔλ\twelveitphotons\twelveitm2\twelveits1\twelveitμm1similar-toabsent9.4superscript109𝜂\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δ𝜆\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑜𝑡𝑜𝑛𝑠\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡superscript𝑚2\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡superscript𝑠1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇superscript𝑚1\sim 9.4\times 10^{9}\ \eta{\twelvesl\Delta}\lambda\ {\twelveitphotons}\ {\twelveitm}^{-2}{\twelveits}^{-1}{\twelveit\mu m}^{-1}. With a band width of \twelveslΔλ=0.3\twelveitμm\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δ𝜆0.3\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇𝑚{\twelvesl\Delta}\lambda=0.3\ {\twelveit\mu m} and assuming a detection efficiency η=0.5𝜂0.5\eta=0.5, it can detect 1.6×107\twelveitphotons\twelveitms11.6superscript107\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑜𝑡𝑜𝑛𝑠\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚superscript𝑠11.6\times 10^{7}\ {\twelveitphotons}\ {\twelveitms}^{-1} using a 4 m telescope with 90 % effective surface area. The expected number of photons from a bulge clump giant, typically H=13.2\twelveitmag𝐻13.2\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑔H=13.2\ {\twelveitmag} (Tiede, Frogel, & Terndrup 1995), will be 67similar-toabsent67\sim 67 \twelveitms1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚superscript𝑠1{\twelveitms}^{-1} assuming an extinction of AH=0.25subscript𝐴𝐻0.25A_{H}=0.25 mag toward the bulge. The sky has a brightness of 14\twelveitmag\twelveitarcsec214\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑔\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑎𝑟𝑐𝑠𝑒superscript𝑐214\ {\twelveitmag}\ {\twelveitarcsec}^{-2} in the H𝐻H band producing an expected sky flux of 71\twelveitphotons\twelveitms171\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑜𝑡𝑜𝑛𝑠\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚superscript𝑠171\ {\twelveitphotons}\ {\twelveitms}^{-1} in an aperture of 1.5 arcsec in diameter. We assume that the occultation occurs when the dimensionless impact parameter x=0.5𝑥0.5x=0.5, and thus the magnification A=2.18𝐴2.18A=2.18. Then the individual magnifications of the image are

A±=x±2x+2x2;x±=x2+4±x2,formulae-sequencesubscript𝐴plus-or-minussubscriptsuperscript𝑥2plus-or-minussuperscriptsubscript𝑥2superscriptsubscript𝑥2subscript𝑥plus-or-minusplus-or-minussuperscript𝑥24𝑥2A_{\pm}={x^{2}_{\pm}\over x_{+}^{2}-x_{-}^{2}};\ \ x_{\pm}={\sqrt{x^{2}+4}\pm x\over 2}, (3.2.1)3.2.1

giving A+=1.59subscript𝐴1.59A_{+}=1.59 and A=0.59subscript𝐴0.59A_{-}=0.59 for the primary and secondary images, respectively. The photon counts for each image are then Nν,1=112\twelveitphotons\twelveitms1subscript𝑁𝜈1112\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑜𝑡𝑜𝑛𝑠\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚superscript𝑠1N_{\nu,1}=112\ {\twelveitphotons}\ {\twelveitms}^{-1} and Nν,2=41\twelveitphotons\twelveitms1subscript𝑁𝜈241\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑜𝑡𝑜𝑛𝑠\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚superscript𝑠1N_{\nu,2}=41\ {\twelveitphotons}\ {\twelveitms}^{-1}. The expected number of detected photons from the individual images and from the sky for various observational situations are computed and listed in Table 1. In the table the signal-to-noise ratio is computed by S/N=Nν/(Nν,1+Nν,2)1/2𝑆𝑁subscript𝑁𝜈superscriptsubscript𝑁𝜈1subscript𝑁𝜈212S/N=N_{\nu}/(N_{\nu,1}+N_{\nu,2})^{1/2}. We assume that other sources of noise, e.g., dark current and read-out noise, are negligible.

The theoretically-expected fringe pattern g/g0𝑔subscript𝑔0g/g_{0} in the H𝐻H band, centered at 1.65\twelveitμm1.65\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇𝑚1.65\ {\twelveit\mu m}, is computed by eq. (3.1.1) and is shown as a function time t𝑡t in Figure 1 (a). In the figure, time is measured from the moment when the first (closer to the Moon) image just crosses the Moon’s limb and negative time implies that the image is behind the Moon. The angular distance is related to time scale by

θ=ωtcosψ,𝜃𝜔𝑡𝜓\theta=\omega t\cos\psi, (3.2.2)3.2.2

where ω𝜔\omega is the orbital angular speed of the Moon and ψ𝜓\psi is the angle of the lunar limb relative to the direction of the Moon’s motion. The total number of photons in the signal is normalized into unity when t=𝑡t=\infty. Due to the phase shift of the Fresnel integrals with time, there are beat patterns. In the simulation, we assume the angular separation between the two images of lensed stars is ϕ\twelveitsep=3\twelveitmassubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝3\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\phi_{\twelveitsep}=3\ {\twelveitmas}, equivalent to an Einstein radius θe1.5\twelveitmassimilar-tosubscript𝜃𝑒1.5\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\theta_{e}\sim 1.5\ {\twelveitmas}, which would be typical for a disk lens located at 2\twelveitkpcsimilar-toabsent2\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑘𝑝𝑐\sim 2\ {\twelveitkpc} with mass of M=0.7M𝑀0.7subscript𝑀direct-productM=0.7\ M_{\odot}. Since the long events are probably caused by relatively massive MACHOs, the expected separation could be greater.

Up until now, our computation has been based on a monochromatic wave observation. However, the H𝐻H-band filter has a finite bandpass. For the correction of band width in our analysis, we average the flux weighted by the filter function. The filter function in the H𝐻H band is well-approximated by the tophat function ω\twelveitfiltersubscript𝜔\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑓𝑖𝑙𝑡𝑒𝑟\omega_{\twelveitfilter}:

w\twelveitfilter={ω0,1.5\twelveitμmλ1.8\twelveitμm0,otherwise,subscript𝑤\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑓𝑖𝑙𝑡𝑒𝑟casessubscript𝜔01.5\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇𝑚𝜆1.8\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇𝑚0otherwise,w_{\twelveitfilter}=\cases{\omega_{0},&$1.5\ {\twelveit\mu m}\leq\lambda\leq 1.8\ {\twelveit\mu m}$\cr 0,&otherwise,\cr} (3.2.3)3.2.3

where ω0=(0.3\twelveitμm)1subscript𝜔0superscript0.3\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝜇𝑚1\omega_{0}=(0.3\ {\twelveit\mu m})^{-1}. The resultant fringe pattern h(θ)𝜃h(\theta), after being averaged by the filter function, is shown in Figure 1 (b). The small-scale fluctuation in flux is smeared out, and thus the beat patterns, which might have been useful for the measurement of ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep}, disappear.

We make the simulation more realistic by including the beam pattern of the telescope. At any time, one edge of the telescope mirror will see an image displaced by a small angle compared to the image seen at the center of the mirror. The resulting image is then the combination of all images seen by different parts of the mirror. The beam pattern decreases with increasing angular separation θ\twelveitpsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝\theta_{\twelveitp} from the center of the mirror because the relative area of the mirror in a strip located at θ\twelveitpsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝\theta_{\twelveitp} decreases as θ\twelveitpsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝\theta_{\twelveitp} increases. For a circular mirror f\twelveitbeam=[1(θ\twelveitp/θ\twelveittel)2]1/2subscript𝑓\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑏𝑒𝑎𝑚superscriptdelimited-[]1superscriptsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑡𝑒𝑙212f_{\twelveitbeam}=\left[1-(\theta_{\twelveitp}/\theta_{\twelveittel})^{2}\right]^{1/2}, where θ\twelveittel=a/2d\twelveitM=1\twelveitmassubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑡𝑒𝑙𝑎2subscript𝑑\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\theta_{\twelveittel}=a/2d_{\twelveitM}=1\ {\twelveitmas} for an assumed aperture a=4\twelveitm𝑎4\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚a=4\ {\twelveitm}. Then the expected intensity h(θ)𝜃h(\theta) is obtained by convolving the intensity h(θ)𝜃h(\theta) with the beam pattern f\twelveitbeam(θ\twelveitp)subscript𝑓\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑏𝑒𝑎𝑚subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝f_{\twelveitbeam}(\theta_{\twelveitp}):

I(θ)=\intf\twelveitbeam(θ\twelveitpθ)h(θ\twelveitp)dθ\twelveitp.𝐼𝜃\intsubscript𝑓\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑏𝑒𝑎𝑚subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝜃subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑑subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝I(\theta)=\int f_{\twelveitbeam}(\theta_{\twelveitp}-\theta)h(\theta_{\twelveitp})d\theta_{\twelveitp}. (3.2.4)3.2.4

The resulting fringe pattern after the beam pattern convolution and being averaged by filter function is shown in Figure 1 (c).


“fourteenit“fourteenbf4.  Uncertainty of Measurement and Observational Strategy

The determination of the angular separation of the two images of a lensed star is made by fitting the observed fringe pattern to a set of light curves with different ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep}. This fitting process suffers from another uncertainty in addition to the one from the angular separation of the images. This uncertainty comes from the ambiguity of a reference point, which is the time of first image occultation, (i.e., θ=0𝜃0\theta=0). A misalignment of the reference point would result in misinterpretation of ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep}. Therefore, we include the misalignment quantified by the shift in the reference point, \twelveslΔt0\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δsubscript𝑡0{\twelvesl\Delta}t_{0}, as a free parameter in our analysis.

The contours of equal uncertainties measured by χ2superscript𝜒2\chi^{2} in the parameter space of \twelveslΔt0\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δsubscript𝑡0{\twelvesl\Delta}t_{0} and ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} are shown in Figure 2 (a) for the first lensing event described in Table 1. The contour levels are drawn at 1σ1𝜎1\ \sigma, 2σ2𝜎2\ \sigma, and 3σ3𝜎3\ \sigma levels from the point of minimum χ2superscript𝜒2\chi^{2} marked by “x”. In the contour map there appear two minima which are located symmetrically about ϕ\twelveitsep=0subscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝0\phi_{\twelveitsep}=0. These two minima appear because of the ambiguity of order of occultation: the fringe pattern when the primary image approaches the Moon first looks similar to the pattern when the other image approaches first. If the two images have exactly the same intensity, there will be no difference in the resultant fringe patterns. The uncertainty is, \twelveslΔϕ\twelveitsep0.55\twelveitmassimilar-to\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝0.55\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠{\twelvesl\Delta}\phi_{\twelveitsep}\sim 0.55\ {\twelveitmas} at the 1σ1𝜎1\ \sigma level. This would be a significant detection although not as precise as one might like.

However, the uncertainty decreases significantly with increasing S/N𝑆𝑁S/N ratio. There are two ways to increase the S/N𝑆𝑁S/N ratio; observing bright stars or highly-magnified events. For illustration, we compute the uncertainties for events under exactly the same conditions as the previous case except for a higher magnification A=3.0𝐴3.0A=3.0 [Fig. 2 (b)] and a 0.5 mag brighter source star [Fig. 2 (c)], which are the second and third cases in Table 1, respectively. For both cases the uncertainty is \twelveslΔϕ\twelveitsep0.35\twelveitmassimilar-to\𝑡𝑤𝑒𝑙𝑣𝑒𝑠𝑙Δsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝0.35\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠{\twelvesl\Delta}\phi_{\twelveitsep}\sim 0.35\ {\twelveitmas} at the 1 σ𝜎\sigma level.


“fourteenit“fourteenbf5.  Practical Considerations

“twelveit5.1  “twelvecpLunar Topography

For an actual observation, one is required to consider some miscellaneous factors that make ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} deviate somewhat from what we have assumed in the computation. The first deviation arises because the Moon’s limb is not a perfect straight line but has a small curvature. If the angular separation between images is big enough (e.g., binary stars), the observed pattern would slightly deviate from the Fresnel diffraction pattern, which assumes an infinite straight-line surface. However, for the scale of <5.5\twelveitmfragmentsfragmentssimilar-toabsent5.5\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}5.5\ {\twelveitm}, which is equivalent to ϕ\twelveitsep<3\twelveitmasfragmentsfragmentssimilar-tosubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝3\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝑎𝑠\phi_{\twelveitsep}\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}3\ {\twelveitmas} projected on the Moon’s surface, the Moon’s limb is a nearly perfect straight line. Indeed, typical errors arising from lunar surface curvature are negligible even for the measurement of a few tens of arcsec (e.g., Richichi et al. 1994). The other type of deviation which “twelveitdoes affect on the measurement of ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} is due to topographical features on the lunar surface. If the images are occulted at different parts of a geological structure on the Moon, e.g., moutains and valleys, the angle ψ𝜓\psi in eq. (3.2.2) deviates from what one assumes based on a smooth circular lunar disk. Assuming that the deviation due to large scale strucures of order km or larger can be corrected using a detailed lunar map, one still has a problem due to smaller-scale structures such as rocks and cliffs. Fortunately, lunar craters and other topographical features are generally not very rugged, and even mountains are very smooth (Abell, Morrison, & Wolff 1993).

“twelveit5.2  “twelvecpOrientation of Images

We have assumed up until now that the orientation of the two images is perpendicular to the approaching limb of the Moon. However, the orientation in general is random and thus what one measures is the component of ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} normal to the Moon’s limb not the intrinsic separation of interest. If one knows exactly how the source star crosses the Einstein ring, it is simple geometry to deduce ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep} from the measured angular separation ϕisubscriptitalic-ϕ𝑖\phi_{i}, where the subscript “i𝑖i” is explained below. However, resolving the orientations of the images is not a trivial problem and requires additional information.

Information about the lens geometry can be obtained from (ground-based) measurement of the parallax. At a minimum, parallax measurements determine the component of the projected velocity parallel to the ecliptic and the magnitude of the component normal to the ecliptic. In general, this still leaves a four-fold degeneracy: two-fold for the sign of the normal component and two-fold for the sense of source motion (clockwise or counterclockwise) relative to observer-lens line of sight. In some cases, especially, if an event is observed away from the ecliptic and has a long time scale, this four-fold degeneracy is completely broken by the parallax measurement itself. Indeed, this is the case for the long-event parallax measured by Bennett et al. (1995). In these cases the geometry is unambiguous and θesubscript𝜃𝑒\theta_{e} can be determined directly from ϕ\twelveitsepsubscriptitalic-ϕ\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑠𝑒𝑝\phi_{\twelveitsep}. However, it is difficult to break this degeneracy when the event is close to the ecliptic. Since the Moon never gets farther than 5similar-toabsentsuperscript5\sim 5^{\circ} from the ecliptic, it is also important to consider the degenerate case.

The four-fold degeneracy can be broken by carrying out occultation observations twice so that the approaching angle, θ\twelveitAsubscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐴\theta_{\twelveitA}, of the Moon’s limb is different for each observation. This can be done either by observing the occultation at two different locations on the Earth or by observing an occultation from the same location a month later. The latter case is possible for long events since the declination of Moon’s orbit typically changes by 1/3similar-toabsent13\sim 1/3 of its diameter per month at fixed right ascension. The four-fold degeneracy of lens geometries is illustrated in Figure 4: transverse velocities pointing below and above the ecilptic are noted by “case I” and “case II”. Subnotations, “(a)” and “(b)”, describe the clockwise and counterclockwise source crossings. For illustration, we assume that the Moon’s limb is approaching the images with θ\twelveitA=45subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐴superscript45\theta_{\twelveitA}=45^{\circ} (“/” sense) and θ\twelveitA=45subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐴superscript45\theta_{\twelveitA}=-45^{\circ} (“\setminus” sense). For each observation shown in the figure the shaded surface indicates the orientation of the surface of the Moon and the shaded arrow indicates the direction of motion. The angular separation that is measured when θ\twelveitA=45subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐴superscript45\theta_{\twelveitA}=45^{\circ} and θ\twelveitA=45subscript𝜃\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝐴superscript45\theta_{\twelveitA}=-45^{\circ} is marked by ϕ1subscriptitalic-ϕ1\phi_{1} and ϕ2subscriptitalic-ϕ2\phi_{2}. For each case the ratios between measured angular separations determined at two different locations (or times), ϕ1/ϕ2subscriptitalic-ϕ1subscriptitalic-ϕ2\phi_{1}/\phi_{2}, are different from one another. Therefore, one can obtain the full lens geometry by ruling out the other three cases from a comparison of the observed ratio ϕ1/ϕ2subscriptitalic-ϕ1subscriptitalic-ϕ2\phi_{1}/\phi_{2} with the expected ratios.

“twelveit5.3  “twelvecpEvent Rate

One can measure proper motions using lunar occultations for about one long time-scale lensing event per year. The occulation can be observed in a strip of sky along the path of the Moon with a width larger than the angular size of the Moon by observing the occultation at higher (or lower) Earth latitudes, ϕitalic-ϕ\phi. The effective occulting cross-section is 1.5similar-toabsentsuperscript1.5\sim 1^{\circ}\hskip-2.0pt.5 assuming the observations could be arranged at places within ϕ=±30italic-ϕplus-or-minussuperscript30\phi=\pm 30^{\circ}. Then the area of sky toward the bulge, with width ±5plus-or-minussuperscript5\pm 5^{\circ} around the Galactic plane, swept by the effective cross-section is 15\twelveitdeg215\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑑𝑒superscript𝑔215\ {\twelveitdeg}^{2}. If the observation could be carried out at more extreme Earth latitudes, the event rate could be increased. The MACHO group has detected 13 giant events out of a total of 44 events during a bulge season by covering 12\twelveitdeg212\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑑𝑒superscript𝑔212\ {\twelveitdeg}^{2} of sky. Three of 44 are long events. The expected occultation event rate is then 3×(13/44)×(15/12)1\twelveitevent/yrsimilar-to3134415121\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑒𝑣𝑒𝑛𝑡𝑦𝑟3\times(13/44)\times(15/12)\sim 1\ {\twelveitevent/yr}. This is substantially higher than the number of proper motions of long lensing events that can be obtained using other methods. Another advantage of the occultation method is that for the long events the measurement could be repeated for better determination of proper motion. Special attention should be paid to observing those fields which the Moon will occult sometime during a given bulge season. For some regions close to the plane, optical observations are impossible due to extinction. However, events can still be detected using H𝐻H or K𝐾K band observations. Indeed, the long events may well be concentrated near the plane (see Fig. 1 from Bennett et al. 1995). Because the long events last many months, it would be sufficient to make these infrared observations once per week compared to once per day for standard optical observations.

“twelvebfAcknowledgement: We would like to thank M. Everett and G. Newsom for making very helpful comments.


REFERENCES \z@plus 1em minus \z@relax1 Abell, G. O., Morrison, D., Wolff, D. C. 1993, Exploration of the Universe (Asunder College Publishing, Philadelphia), 222 relax2 Alcock, C. et al. 1995, ApJ, 445, 133 relax3 Bennett, D. P. et al. 1995, Proceedings of the Fifth Annual Maryland Meeting on Astrophysics: Dark Matter, S. S. Holt, C. L. Bennett, eds., in press relax4 Gould, A. 1992, ApJ, 392,442 relax5 ————- 1994, ApJ, 421, L71 relax6 ————- 1995, ApJ, 447, 000 relax7 Gould, A., Miralda-Escudé, J., & Bahcall, J. N. 1994, ApJ, 423, L105 relax8 Griest, K. et al. 1991, ApJ, 387, 181 relax9 Han, C., & Gould, A. 1995a, ApJ, 447, 000 relax10 —————————– 1995b, ApJ, submitted relax11 Hecht, E. & Zajac, A. 1979, Optics (Addison-Wesley Publishing Company, Reading), 385 relax12 Kiraga, M., & Paczyński, B. 1994, ApJ, 430, L101 relax13 Nemiroff, R. J. & Wickramasinghe, W. A. D. T.  1994, ApJ, 424, L21 relax14 Richichi, A., Calamai, G., & Leinert, C. 1994, A&A, 286, 829 relax15 Tiede, G. P., Frogel, J. A., & Terndrup, D. M. 1995, AJ, submitted relax16 Udalski, A., Szymański, M., Stanek, K. Z., Kalużny, J., Kubiak, M., Mateo, M., Krzemiński, B., & Venkat, R. 1994, Acta Astron., 44, 165 relax17 Witt, H. 1995, ApJ, in press relax18 Zhao, H., Spergel, D. N., & Rich, R. M. 1995, ApJ, 440, L13