“twelveit

“twelvebfCosmological Origin of Quasars


ABRAHAM LOEB

“twelveitAstronomy Department, Harvard University

“twelveit60 Garden St., Cambridge, MA 02138

Contribution to the Texas Symposium, Munich, Dec. 1994

“twelvebfINTRODUCTION

Observations of high-redshift quasars and absorption systems provide a rich data set on the early formation of structure in the universe. Theoretical and observational investigation of the physics leading to the formation of quasars and their environments can shed some light on early structure formation. In this contribution, I summarize briefly a few aspects of quasar physics that are of cosmological interest.

“twelvebfORIGIN OF QUASAR BLACK HOLES

The most recent evidence that massive black holes exist in the centers of galaxies comes from the existence of compact gaseous disks with high rotation velocities. Examples include the HST imaging and spectroscopic observations1 of M87 that revealed a 20\twelveitpcsimilar-toabsent20\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑐\sim\!20~{}{\twelveitpc} disk with a rotation velocity of 500\twelveitkms1similar-toabsent500\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑘𝑚superscript𝑠1\sim\!500~{}{\twelveitkm~{}s^{-1}} and implied the presence of a 2×109M2superscript109subscript𝑀direct-product2\times 10^{9}M_{\odot} black hole, and VLBA observations2 of the powerful water maser emission from a 0.1\twelveitpcsimilar-toabsent0.1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑐\sim\!0.1~{}{\twelveitpc} disk rotating at 103\twelveitkms1similar-toabsentsuperscript103\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑘𝑚superscript𝑠1\sim\!10^{3}~{}{\twelveitkm~{}s^{-1}} at the center of NGC 4258. In the latter case, the central mass density exceeds 4×109M\twelveitpc34superscript109subscript𝑀direct-product\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝superscript𝑐34\times 10^{9}M_{\odot}~{}{\twelveitpc}^{-3} and is unlikely to be associated with anything other than a central black hole with a mass of 4×107M4superscript107subscript𝑀direct-product4\times 10^{7}M_{\odot}. Independent observational constraints on the compactness of the energy source in active galactic nuclei come from unresolved lensed images (indicating3 a source size <1\twelveitpcfragmentsfragmentssimilar-toabsent1\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑝𝑐\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}1\,{\twelveitpc} from HST imaging of the quasar 2237+0305), gravitational microlensing (indicating4 a continuum source of size <2×1015\twelveitcmfragmentsfragmentssimilar-toabsent2superscript1015\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑐𝑚\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}\!2\times 10^{15}\,{\twelveitcm} in 2237+0305), milliarcsecond jets (showing an unresolved core <1017\twelveitcmfragmentsfragmentssimilar-toabsentsuperscript1017\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑐𝑚\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}\!10^{17}\,{\twelveitcm} in some objects5), and rapid X-ray variability6.

The integrated light of quasars can be used to find the minimum mass density of black hole remnants today. This calculation7 implies that a fraction >3×105fragmentsfragmentssimilar-toabsent3superscript105\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}3\times 10^{-5} of all the baryons in the universe have ended inside black holes. Formation of black holes must therefore be a non-negligible consequence of gravitational instability in the early universe, yet the origin of these 10610Msimilar-toabsentsuperscript10610subscript𝑀direct-product\sim\!10^{6-10}M_{\odot} black holes in standard cosmologies is enigmatic8. In fact, most of the luminous mass in the universe is locked up in gas and stars that are prevented from condensing in the centers of galaxies by their angular momentum. A galaxy as a whole is a highly non-relativistic system which has a typical size that is (v/c)2106similar-tosuperscript𝑣𝑐2superscript106(v/c)^{-2}\sim\!10^{6} times bigger than its Schwarzschild radius. Loeb & Rasio9 have performed hydrodynamic simulations of the collapse of protogalactic gas clouds and concluded that baryons are unlikely to reach a relativistic state by merely sinking spontaneously to the center of a galaxy, unless a massive (>106Mfragmentsfragmentssimilar-toabsentsuperscript106subscript𝑀direct-product\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}\!10^{6}M_{\odot}) seed black hole is already in existence there. Without a massive seed, the rotationally-supported cold gas is strongly unstable to fragmentation due to its self-gravity, and is converted to stars long before it approaches relativistic scales. However, if a central massive seed is artificially added to the system, it could dominate gravity near the center and stabilize a smooth accretion disk of gas around it. The minimum seed mass necessary for that purpose, 106Msimilar-toabsentsuperscript106subscript𝑀direct-product\sim\!10^{6}M_{\odot}, is consistent with the existence of a lower bound on the empirically determined black hole masses in active galactic nuclei. Various such determinations10 all yield black hole masses >106Mfragmentsfragmentssimilar-toabsentsuperscript106subscript𝑀direct-product\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}\!10^{6}M_{\odot}, with the lowest mass objects not necessarily being close to the detection threshold. Nevertheless, it is puzzling as to why a small fraction of the mass in the universe ended up in relativistic seeds while the rest was strongly prevented from doing so by its angular momentum. To answer this question, we must first consider the origin of angular momentum of collapsing systems in cosmology.

An initially overdense region in the universe that eventually forms a virialized object acquires angular momentum about its center of mass through tidal torques from its environment11. It is therefore possible to imagine that different environments could result in different amounts of rotation for the final virialized object. As the initial conditions can be well-specified in terms of a Gaussian random field of density perturbations with some power-spectrum, one can calculate the distribution function of angular momenta for collapsed objects in the universe either numerically12 or analytically11,13. This distribution has a tail of low-spin objects which by chance happened to reside in an environment with a low tidal shear. When the analytical calculation is extended into the far low-spin tail of this distribution one finds an astrophysically interesting abundance of low-spin objects13. The cosmological collapse of low-spin systems is found to be close to spherical because of their spherical initial shape, and the low shear in their cosmological environment. In addition, because of the unusually low amplitude of the external shear, the gas in these systems is unlikely to be disrupted by external torques before it forms a compact disk. In more than 104similar-toabsentsuperscript104\sim\!10^{-4} of the objects on the 1067Msuperscript1067subscript𝑀direct-product10^{6-7}\!M_{\odot} mass scale, the baryons can settle after the initial collapse and cooling phases to a compact disk of an initial size 1017\twelveitcmsimilar-toabsentsuperscript1017\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑐𝑚\sim\!10^{17}~{}{\twelveitcm} and a rotation velocity >500\twelveitkms1fragmentsfragmentssimilar-toabsent500\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑘𝑚superscript𝑠1\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}\!500~{}{\twelveitkm~{}s^{-1}}. Because of its small initial size, such a disk has a viscous evolution time <106\twelveityrfragmentsfragmentssimilar-toabsentsuperscript106\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑦𝑟\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}\!10^{6}~{}{\twelveityr}, shorter than the characteristic time it takes a star or a supernova to form in it. The compact disk is therefore expected to evolve into a seed black hole13. Most of these seed black holes form just above the cosmological Jeans mass and have a mass 106Msimilar-toabsentsuperscript106subscript𝑀direct-product\sim\!10^{6}M_{\odot}.

Each galactic bulge contains about 104similar-toabsentsuperscript104\sim\!10^{4} subunits on the 106Msuperscript106subscript𝑀direct-product10^{6}M_{\odot} mass scale. Among these subunits there is a class of rare objects that are high density peaks which acquire low angular momentum during their cosmological collapse. These high peaks collapse early (z>20fragmentsfragmentssimilar-to𝑧20z\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}\!20), long before any other object in their nearby environment starts to form. Because of its low angular momentum, the gas in these rare peaks forms a deep potential well as it cools to a compact disk. The initial disk can then evolve to a massive black hole on a short viscous timescale (<106fragmentsfragmentssimilar-toabsentsuperscript106\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr<\crcr\sim\crcr} }}}10^{6} years), well before star formation or supernovae could act to disrupt it. After the bulge of the surrounding galaxy virializes, the already formed seed sinks to the center of the potential-well by dynamical friction. This process provides just the initial 106Msuperscript106subscript𝑀direct-product10^{6}M_{\odot} seed necessary to stabilize later accretion of gas around the center9. The later accretion allows the further growth of the black hole there. Qualitatively, the above sequence of events must take place at some level in the universe. The only open question is quantitative: “twelveitfor a given power spectrum of initial density perturbations, what fraction of the 104superscript10410^{4} subunits belongs to this low-spin class?

An analytical calculation of the distribution function of angular momenta13 shows that there is of order one low-spin subunit per bright galaxy, which is a >2.5σabsent2.5𝜎>\!2.5\sigma peak with 1067superscript106710^{6-7} solar masses in gas and is capable of forming a black hole seed shortly after its initial cosmological collapse. In principle, it is also possible to get black hole binaries in galactic centers by the formation and sinking of more than one seed per galaxy. If more than two seeds sink to the center, slingshot ejection of black holes from the bulge becomes important.

It can be shown mathematically11 that a high density peak on the 1067Msuperscript1067subscript𝑀direct-product10^{6-7}M_{\odot} mass scale is very likely to be surrounded by a high density region on the 1010Msimilar-toabsentsuperscript1010subscript𝑀direct-product\sim\!10^{10}M_{\odot} mass scale. Therefore, the seed black holes that form out of high peaks are very likely to be surrounded by galactic mass systems that collapse later and feed them with additional gas, thus resulting in the bright quasar activity13. The observed maximum in the comoving quasar density at z2𝑧2z\approx 2 may just reflect the epoch of galaxy formation when considerable infall feeds these seed black holes14. The subsequent decline in the abundance of bright quasars at low redshifts would then result from the dilution of their gas supply. The lack of starlight around some nearby quasars15 may indicate that star formation does not necessarily precede the accretion process.

There are various observational ways to probe the above sequence of events. Searches for the progenitors of quasars at very high redshifts (z>10fragmentsfragmentssimilar-to𝑧10z\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}10) may be best undertaken in the infrared or millimeter regimes; optical surveys are limited by intrinsic dust extinction or intergalactic absorption. The emission of fine-structure lines from the host systems of quasars can be detected by millimeter telescopes and provide information about the velocity dispersion and gas content of the hosts16. For example, the [C II] 158 μ𝜇\mum line flux from a bulge surrounding a bright quasar at a redshift of 101010 can reach 2\twelveitmJysimilar-toabsent2\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑚𝐽𝑦\sim\!2~{}{\twelveitmJy}, and be detected at the 3σ3𝜎3\sigma level with a 1” beam and a velocity resolution of 150\twelveitkms1150\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑘𝑚superscript𝑠1150~{}{\twelveitkm~{}s^{-1}} after 40 minutes of integration by the future Millimeter Array telescope.

A novel method to set a lower limit on individual quasar lifetimes makes use of the Lyα𝛼\alpha forest17. It is well-known that the ionizing radiation from a bright quasar can dilute the population of Lyα𝛼\alpha clouds in its vicinity out to a characteristic distance of 1078similar-toabsentsuperscript1078\sim\!10^{7-8} light years18. When lines of sight separated by 1similar-toabsentsuperscript1\sim\!1^{\circ} from the line of sight to the quasar are used to probe this “proximity effect”, they are sensitive to radiation that left the quasar 1078similar-toabsentsuperscript1078\sim\!10^{7-8} years earlier than the radiation arriving from the quasar today. Therefore, two lines of sight can be used to set a lower limit on the quasar lifetime. By coincidence, this limit happens to be just in the regime of interest for the expected duty cycle of quasars14.

“twelvebfPROBING CLUSTERING AT HIGH REDSHIFTS

“twelvebfTHROUGH QUASAR ABSORPTION LINES

If quasars form in high density regions then they are likely to be surrounded by concentrations of galaxies. Groups and clusters of galaxies hosting a quasar can be found through the detection of Lyα𝛼\alpha absorption lines beyond the quasar redshift. The effect occurs whenever the peculiar velocities of the quasar and the Lyα𝛼\alpha~{}clouds combine to lower the quasar redshift below that of its nearest Lyα𝛼\alpha~{}cloud. For this to be observable, the distortion to the redshift distribution of Lyα𝛼\alpha~{}clouds induced by the cluster potential must extend beyond the proximity effect of the quasar. For any specific cosmological model, it is possible to predict the probability for finding lines beyond the quasar redshift (z\twelveitabs>zQsubscript𝑧\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑎𝑏𝑠subscript𝑧𝑄z_{\twelveitabs}>z_{{}_{Q}}) under the assumption that the physical properties of Lyα𝛼\alpha~{}clouds are not affected by flows on large scales (>\twelveitMpcfragmentsfragmentssimilar-toabsent\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑀𝑝𝑐\mathrel{\mathchoice{\vbox{\offinterlineskip\halign{$\m@th\displaystyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\textstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}{\vbox{\offinterlineskip\halign{$\m@th\scriptscriptstyle\hfil#\hfil$\cr>\crcr\sim\crcr} }}}\!{\twelveitMpc}) in the quasi-linear regime. If quasars randomly sample the underlying galaxy distribution, the expected number of lines with z\twelveitabs>zQsubscript𝑧\𝑡𝑤𝑒𝑙𝑣𝑒𝑖𝑡𝑎𝑏𝑠subscript𝑧𝑄z_{\twelveitabs}>z_{{}_{Q}} per quasar can be as high as 0.25×[(dN/dz)/350]similar-toabsent0.25delimited-[]𝑑𝑁𝑑𝑧350\sim\!0.25\times[(dN/dz)/350] at z=2𝑧2z=2 for Cold Dark Matter cosmologies, where dN/dz𝑑𝑁𝑑𝑧dN/dz is the number of Lyα𝛼\alpha~{}lines per unit redshift far from the quasar19. The probability is enhanced if quasars typically reside in small groups of galaxies. In addition, a statistical excess of Lyα𝛼\alpha~{}lines is expected near very dim quasars or around metal absorption systems. The expected magnitude of these clustering effects should be detectable by forthcoming observations with the Keck telescope. Finally, it can be shown19 that the standard approach to the proximity effect overestimates the ionizing background flux at high redshifts by up to a factor of 3similar-toabsent3\sim 3, as it ignores clustering. This result weakens the existing discrepancy between the deduced background flux and the contribution from the known population of quasars.


“twelvebfACKNOWLEDGEMENTS

I thank Daniel Eisenstein, Fred Rasio, and Ed Turner for many fruitful discussions.


“twelvebfREFERENCES

1. Ford, H. C., et al. 1994, ApJL, 435, 27; Harms, R. J., et al. 1994, ApJL, 435, L35 2. Miyoshi, M. et al. 1995, Nature, Jan. 12th issue 3. Rix, H. W., Schneider, D. P., & Bahcall, J. N. 1992, AJ, 104, 959 4. Rauch, K. P., & Blandford, R. 1991, ApJ, 381, L39 5. Baath, L. B., et al. 1992, A& A, 257, 31 6. Remillard, R. A., et al., 1991, Nature, 350, 589 7. Sołtan, A. 1982, MNRAS, 200, 115; Chokshi, A., & Turner, E. L. 1992, MNRAS, 259, 421 8. Turner, E. L., 1991, AJ, 101, 5 9. Loeb, A., & Rasio, F.A. 1994, ApJ, 432, 52 10. Peterson, B. M. 1993, PSAP, 105, 247; Wandel, A., & Mushotzki, R. F. 1986, ApJ, 306, 61; Netzer, H. 1990, in Active Galactic Nuclei (Berlin: Springer); Wandel, A., & Yahil, A. 1985, ApJL, 295, 61; Padovani, P., Burg, R., & Edelson, R. A. 1990, ApJ, 353, 438 11. Eisenstein, D., & Loeb, A. 1995, “An Analytical Model For The Triaxial Collapse of Cosmological Perturbations”, ApJ, in press 12. Warren, M. S., Quinn, P. J., Salmon, J. K., & Zurek, W. H. 1992, ApJ, 399, 405 13. Eisenstein, D., & Loeb, A. 1995b, “Origin of Quasar Progenitors From The Collapse of Low-Spin Cosmological Perturbations”, ApJ, in press 14. Haehnelt, M. G., & Rees, M. J. 1993, MNRAS, 263, 168 15. Bahcall, J. N., Kirhakos, S., & Schneider, D. P. 1994, ApJL, 435, 11 16. Loeb, A. 1993, ApJL, 404, 37 17. Loeb, A., & Maoz, E. 1995, in preparation 18. Bechtold, J. 1994, ApJS, 91, 1 19. Loeb, A., & Eisenstein, D.J. 1995, ApJ, in press