Leveraging Retrieval-Augmented Generation and Large Language Models to Predict SERCA-Binding Protein Fragments from Cardiac Proteomics Data

Abstract.

Large language models (LLMs) have shown promise in various natural language processing tasks, including their application to proteomics data to classify protein fragments. In this study, we curated a limited mass spectrometry dataset with 1000s of protein fragments, consisting of proteins that appear to be attached to the endoplasmic reticulum in cardiac cells, of which a fraction was cloned and characterized for their impact on SERCA, an ER calcium pump. With this limited dataset, we sought to determine whether LLMs could correctly predict whether a new protein fragment could bind SERCA, based only on its sequence and a few biophysical characteristics, such as hydrophobicity, determined from that sequence. To do so, we generated random sequences based on cloned fragments, embedded the fragments into a retrieval augmented generation (RAG)database to group them by similarity, then fine-tuned large language model (LLM) prompts to predict whether a novel sequence could bind SERCA. We benchmarked this approach using multiple open-source LLMs, namely the Meta/llama series, and embedding functions commonly available on the Huggingface repository. We then assessed the generalizability of this approach in classifying novel protein fragments from mass spectrometry that were not initially cloned for functional characterization. By further tuning the prompt to account for motifs, such as ER retention sequences, we improved the classification accuracy by and identified several proteins predicted to localize to the endoplasmic reticulum and bind SERCA, including Ribosomal Protein L2 and selenoprotein S. Although our results were based on proteomics data from cardiac cells, our approach demonstrates the potential of LLMs in identifying novel protein interactions and functions with very limited proteomic data.

1. Introduction

Conventional machine learning algorithms have provided powerful frameworks for analyzing proteomics data (Beck et al., 2024). However, these models often involve trade-offs between computational cost, data requirements, and accuracy. In recent years, LLM s have gained traction as potentially inexpensive alternatives to analyze new data with minimal or no training required. LLMs are a type of neural network trained on massive amounts of text data for tasks such as zero-shot sentence completion, where the model predicts the following words in a sequence without additional training. In particular, several LLMs have been specifically designed to relate protein sequences to structure, including ProtTrans (Elnaggar et al., 2022) and ESM (Lin et al., 2023). The field is rapidly evolving, including advances that incorporate physics engines and machine learning for de novo protein design and analysis (Ghafarollahi and Buehler, 2024). Progress has also been made in the integration of language models with geometric deep learning approaches to predict functionalities including protein-protein interfaces, docking, binding constants (Wu et al., 2023), and coevolutionary patterns (Sgarbossa et al., 2023). These approaches exemplify the potential power and novelty of using LLMs to connect amino acid sequences to a broad range of biological phenomena.

Although LLM s demonstrate impressive zero-shot performance, their accuracy often benefits from additional relevant information. Fine-tuning LLMs is a common strategy for tailoring them to specific tasks, but it typically requires significant data, computational resources, and expertise. Retrieval augmented generation (RAG)offers a more recent approach. It allows users to create a searchable local database that can be queried first to extract relevant information before consulting the LLM. RAG databases are typically constructed by partitioning documents into smaller ”chunks” that are then transformed into numerical vectors using embedding functions (Lewis et al., 2020). These functions create vector representations that can be easily understood and processed by LLMs. Therefore, RAGs have the potential to enhance existing LLMs adapted for proteomics without the need for additional training. However, building and querying RAGs for optimal LLM performance can be a complex and laborious undertaking.

In this study, we used the paradigm retrieval augmented generation (RAG) to predict the biophysical properties of protein fragments based on a larger data set curated from mass spectrometry-based proteomic analysis (unpublished). The fragments originate from heart tissue, specifically within the endoplasmic reticulum (ER) of heart cells. These protein fragments are believed to integrate into the ER membrane as transmembrane peptides, potentially binding to and disrupting the normal function of the sarcoplasmic reticulum calcium ATPase (SERCA), a calcium pump (Bers, 2001). This manner of SERCA regulation is already well-established for other single-pass helical structures such as phospholamban (PLN)(MacLennan and Kranias, 2003) and dwarf open reading frame (DWORF) (Makarewich et al., 2018).

A small, representative subset of the fragments was experimentally characterized in a separate study (Phillips Et al., MS in prep) to assess their impact on SERCA. Our goal is to utilize these data to predict the ability of yet-uncharacterized fragments to modulate SERCA activity.

2. Methods and Development

2.1. Data set

Tissue

Left ventricle tissue was collected from dilated cardiomyopathy (DCM) and non-failing human donor hearts. Triplicate samples were used for each group. The tissue was homogenized and fractionated by ultracentrifugation. The membrane fraction was retained from all samples and subjected to SDS-PAGE. Bands below 25 kD were excised from the gel. Gel pieces were subject to reduction with 10mM DTT and in-gel trypsin digestion. Protein was extracted from gel in preparation for mass spectrometry and resuspended in 3% acetonitrile to a final concentration of 500 ng/uL.

Proteomics

The excised bands were subjected to MS analysis via the Orbitrap Eclipse™ Tribrid™ Mass Spectrometer (FSN04-10000). The dataset contained approximately 8,900 fragments obtained through digestion of roughly 1800 proteins. The protein fragments identified by MS were 15-30 amino acids in length. We selected 300 of which based on their 3-fold higher differential expression in DCM tissue relative to rejected transplants. We consulted UniProt [2] to select the subset comprising approximately 100 sequences that were confirmed to be localized in the ER and belong to a known transmembrane protein. Protein sequences corresponding to the ER-enriched TM data set were provided in FASTA format, where each of the twenty natural amino acids is represented by a single letter code. From this subset, we selected 10 fragments that bore a sequence similarity to a known SERCA inhibitor, phospholamban, for experimental characterization.

Functional characterization

The procedure for characterization included cloning selected fragments into fluorescently tagged vector and transfection into HEK293T cells. Localization of protein fragments compared to SERCA was observed via structured illumination microscopy (SIM). Binding to SERCA was quantified via FRET microscopy and a KD value of 20 or under was used as a binary cutoff for high binding affinity. Consequently, the fragments were annotated with 1 or 0 for the activity attributes of binding SERCA.

Data format and random sequence generation

Since most of the 10 cloned sequences bound SERCA, we generated randomized sequences derived from the training set to achieve a larger and more balanced dataset. For our generation strategy, we assumed that conservative amino acid replacements, such as aspartic acid (Asp) to glutamic acid (Glu), would result in ‘child’ sequences that retained the activity of their ‘parent’ sequences. We subjected each parent sequence to a single mutation event at a randomly chosen replacement site, generating a single sequence. Progeny from one generation would serve as parents for a successive mutation step. This mutation and progeny generation process was iteratively applied to both parent and child sequences until a sufficient number of sequences ($\approx$ 250) were generated to achieve a nearly balanced state for the dataset.

2.2. Retrieval augmented generation (RAG)+ Large language model (LLM)

RAG

A RAG approach (Salemi and Zamani, 2024) was used in lieu of fine-tuning to augment pre-trained LLM s with information from our proteomics dataset. Namely, a vector database was constructed with the dataset entries denoted as binding SERCA (1) or not binding SERCA (0) from the random mutagenesis strategy described above. This was achieved by creating chunks (subsets) of the data with overlaps between adjacent chunks. These chunk sizes and overlaps were treated as hyperparameters. Embedding functions were selected from the Hugging Face repository, including examples such as chroma and faiss. These embedding functions were used to map each input sequence to a corresponding vector with hundreds of floats. This was achieved using the langchain-community python libraries.

Clustering and feature expansion

We partitioned the embedded data vectors onto a 2D plane using UMAP (McInnes et al., 2018), which is available as a python library. UMAP aims to uniformly distribute data points along a manifold that reflects a ‘local’ distance between neighboring points (McInnes et al., 2018), as defined by the points’ embeddings. The points were then clustered using K-means via scikit-learn package, after which we retained a user-defined number of clusters. In this fashion, fragments that share similar sequences and potentially SERCA-binding capacity, would reside in the same cluster. A member of each cluster was further evaluated, namely the computation of its hydrophobic score, length, and charge density. We assumed that these physicochemical properties might be strong determinants of SERCA binding. See Sect. A.2 for their respective definitions. These additional evaluations were appended to the input sequences that are later used for chain-of-thought prompting of the LLM s. These attributes were also estimated for the novel sequences that were classified by the LLM s.

Human-guidance

We also created a jupyter notebook (manual_select.ipynb) to provide human-guided partitioning of the training data sets for supplemental annotation of the sequences. Namely, we provide an option to assign a classification scheme to sequences, such as 0 for hydrophobic, 1 for polar, and 2 for charged. The numerical values were used to color-code the sequences. The user is then asked to select sequences from a randomized set that are most similar to an input sequence. If the user is able to reliably classify the structures by eye, the classification scheme is used to add additional features to each input sequence or to fine-tune the LLM prompts, such as by reflecting observations of charge or hydrophobicity.

LLM prompting

Prompts were compiled based on a chain of thought prompting (Wei et al., 2022) using Input/Output pairs, followed by a query to predict the output of a novel sequence. Namely, we provided several input/output pair examples with explanations of their sequences and properties. As an example, the prompts could assume the form of the following:

• I have a list of input/output pairs, where the input includes an amino acid sequence, a score, a length, and a hydrophobicity score, and the output is 1 or 0 if it binds a target protein. Input: REGPPFISEGYAVRG0,0.118,16,0.2 Output: 0; RNLQSEVDYGVKN1,0.111,14,0.3 Output: 1 Predict whether the following input has an output of 1 based first on its similarity to other sequences and their scores, make sure to explain each step: RNKTEDLEATSEHFRYT1,0.115,18,0.4

Additional examples are included in Sect. A.1 and our github repository. These prompts are submitted to an LLM (see Table 2) as a conversation chain, which is effectively a chatbot framework provided by langchain. Its responses were then parsed for predictions. Performance was assessed for testing sets randomly generated without replacement from 10% of the sequence data. F1, accuracy, and recall scores were computed with scikit-learn for several iterations of each embedding/LLM combination.

3. Results and Discussion

3.1. Characterization of sequences derived from clone protein fragments

Several fragments were identified by mass spectrometry that were ultimately cloned (see Table 1). In Fig. 4 we show the fragments and their approximate locations in the encoded proteins, largely based on predicted structures from Alphafold (Jumper et al., 2021). For the transmembrane protein 50A (TMEM50A, O95807), the fragment is a loop located between two transmembrane helices. The functional role of TMEM50A is not well-established, though its bundle of four amphoteric helices suggests its localization to cell membranes. For the small integral membrane protein 13 (SMIM13, P0DJ93), one fragment is positioned far from the transmembrane helix, while another is adjacent. The in vivo SMIM13 function has not yet been determined, but its resemblance to PLN is suggestive of its potential to interfere with SERCA function. For vesicle-associated membrane protein 3 (VAMP3, Q15836) and VAMP8 (Q9BV40), the fragments are derived from the proteins’ cytosol-facing N-termini (not shown). VAMPs are well-known structures anchored in cell membranes that facilitate membrane fusion via SNARE complexes (Hu et al., 2007). For the ER membrane protein complex subunit 6 (EMC6, Q9BV81), the first fragment is adjacent to the transmembrane helix, while the second fragment is part of the helix’s terminus. EMC6 was found to play an important role in autophagy (Li et al., 2013). For the transmembrane protein 14C (TMEM14C, Q9P0S9), the identified fragment spans a loop between two helices, based on NMR structures available from PDB Accession code 2LOS (Klammt et al., 2012). Finally, in the SEC61 translocon subunit beta (SEC61B, S4R3B5), the fragment is located just after the transmembrane helix (not shown). This subunit plays an important role in protein transport across the ER membrane (Rapoport, 2008). Hence, the fragments almost exclusively are found outside of the transmembrane helices.

Since we have just a small number of cloned constructs available for model training, we expanded the dataset via generate constructs with one or more randomly-selected conservative replacements (such as D to E). This procedure was used to create approximately two hundred high-homology variants of the original cloned dataset. We also emphasized the generation of constructs that did not bind SERCA (namely EMC6 and TMEM14C), in order to generate a balanced dataset with comparable numbers of binders and non-binders.

3.2. Analysis of the data set

Fig. 2 summarizes characteristics of the SERCA-binding and non-binding protein fragments in our data set. Fig. 2A counts the number of each amino acid type in the binding (blue) and nonbinding (orange) sequences. The hydrophobic residues are presented initially (A-W), followed by the polar ones (Y-T), and finally, the charged amino acids (D, E, K, R). The binding sequences appear to have slightly higher numbers of polar and charged amino acids, but otherwise the counts are similar. The lengths of the fragments in Fig. 2 B suggest that the longest sequences tend to bind to SERCA, but shorter sequences are intermixed. Panel C suggests some tendency for binding sequences to have charge densities greater than 0.3, whereas non-binding sequences generally are less charged. This trend is reasonable, given that the fragments were largely found adjacent to transmembrane peptides, and thus would be expected to favor polar residues in cytosolic and lumenal environments. Hence, although some small trends emerge, in general these features do not exhibit clear separation between the two groups, suggesting a non-trivial relationship with ER localization to bind SERCA. This aligns with our previous work (Sun and Kekenes-Huskey, 2023), where ultimately we used decision trees to effectively classify proteins with complex property-target relationships.

3.3. Retrieval augmented generation (RAG)

3.3.1. Embedding

Numerous machine learning methods, including LLM s exist for protein property classification based on sequence data (Wasim et al., 2024; Wang et al., 2024; Krishna et al., 2024; Abramson et al., 2024). This study aimed to assess the potential of pre-trained LLM s to perform this task without fine-tuning. To achieve this, we employed a retrieval-augmented generation (RAG) approach (Ke et al., 2024) that leverages embeddings to capture meaningful relationships between tokens from the fragments’ FASTA sequences. By encoding these sequences as numerical vectors, we enabled the retrieval of similar entries from a local RAG database. Namely, the transformation from alphanumeric representations to vector embeddings ensures that sequences with shared features, e.g. sequence motifs, are positioned closely in the embedding space. These retrieved sequences are then used to construct prompts for the LLM, allowing it to generate contextually relevant outputs. In this fashion we bridge the gap between the static knowledge of pre-trained LLMs and the dynamic requirements of sequence-specific analyses of protein fragments.

We analyzed the embeddings for the hundreds of sequences used for training in the compiled RAG database. This was done by projecting them onto a 2D plane using UMAP (see Fig. 3A). Similar sequences, such as those differing by a few amino acids, are found to colocalize with each other in a UMAP projection (see Fig. 3). Moreover, sequences that were categorized as binding versus not binding appear to have nonoverlapping distributions. Namely, binding sequences (filled) appear to be well separated from non-binding sequences (outline) in this large dataset. Anecdotally, sequences within a given UMAP cluster seem to have similar characteristics, such as a high abundance of glutamine in the fragment from VAMP3 (Table 1) that might also be similar to another TM protein like PLN (Table 3). This similarity becomes critical in the RAG step, for which we seek to match a trial sequence to a sequence with a known binding phenotype.

Using the separation observed in UMAP (Fig. 3B), we clustered the data using k-means to obtain a representative subset of the complete training set. Fig. 3C summarizes cluster sizes with bars shaded by Shannon entropy (Eq. 1). The black bars represent clusters with an entropy approaching 0 (nearly homogeneous), while the white bars indicate an entropy approaching 1 (maximally mixed). Ideal partitioning and clustering would yield clusters with entropies close to 0, signifying groups with a single output value. We randomly selected one data point from each k-means cluster (Figure Fig. 3C) to represent local distributions in the UMAP projection. The sequences associated with these cluster representatives were scored using the matching results from the RAG query.

3.3.2. Appending data

Since other physical properties, such as charge density, would be expected to play a role in binding SERCA, each sequence was evaluated for charge density, fragment length, and hydrophobicity (see Section A.2). While these computationally inexpensive metrics provide limited biophysical detail, they serve as placeholders for more detailed calculations in future studies. The scalar values for biophysical properties were appended to the input sequences, creating a combined FASTA format with sequence and numeric data, such as

Input: RLQQTQNQVDEVIDIMRV0,0.116,20,0.3 Output:1;
Input: REGPPFISEAAIRG0,0.139,15,0.3 Output: 0;

This process was repeated for the test sequences.

3.3.3. Chain of Thought Inquiry

Finally, after appending the features to the sequences, we compiled them into the LLM prompts. Namely, the training data composed of the modified FASTA sequences and their SERCA binding phenotype were constructed as a chain of thought LLM prompt:

I have a list of input/output pairs, where the input includes an amino acid sequence,
a score, length, and a hydrophobicity score, and the output is 1 or 0 if it binds
a target protein.
Input: RLQQTQNQVDEVIDIMRV0,0.116,20,0.3 Output:1;
.....
Based on the provided inputs and outputs, predict the output of the following inputs:
RELVGDTGSQEGDHEPSGSETEEDTSSSPHRI0,0.098,33,0.3;
....

We generally selected for 10 input/output pairs for the prompt and requested the LLM to predict the phenotype for test data. We included instructions in the prompt to format the responses into phrases that could be easily extracted for benchmarking. The test sequences were not used for training and were scrubbed of the assigned SERCA binding phenotype.

3.4. Benchmarking performance

To benchmark our data, we randomly divided the data set into 90% for training and 10% for testing. The predictions of the test data were compared with the true values for metrics such as F1 scores and accuracy. This process was repeated for 5 iterations. Table 2 summarizes the F1 scores for various LLMs and embedding functions. Scores approaching 1.0 represent strongly performing LLM/embedding combinations. Specifically, we found that the llama3b:70b gave the best performance by the F1 score ($0.96\pm 0.06$) when used with e5-small-v2 embedding, 1000 character chunking, and 0 character overlap. These parameters are summarized in Table 5. The best performance was demonstrated with the larger LLM models (70b with 70 B parameters) and small (512 tokens) embeddings. We note that the different embeddings exhibited similar performances with the larger models, from which the rankings could moderately vary between benchmarking runs.

We further optimized hyperparameters, including the number of clusters and whether secondary attributes like charge density were appended to input/output pairs. Notably, omitting the ragScore yielded a modest improvement in F1-score (2⁰ attributes, $0.95\pm 0.064$). In contrast, not clustering sequences by UMAP resulted in the lowest score (clusterSequences=False, $0.66\pm 0.256$). This suggests that distances between embeddings for a set of peptides were more important than their scoring method when queried. We did not vary chunk and overlap parameters, as these are typically relevant for large documents with smaller vector spaces. In our case, the entire sequence line was generally shorter than the length requirements of a given vector.

3.5. Application to ’novel’ fragments

3.5.1. Positive controls

We evaluated classification performance using fragments identified by mass spectrometry from proteins whose potential to bind to ER proteins is known. These included phospholamban (PLN), a known SERCA regulator (Traaseth et al., 2008) and phospholemman (FYXD1), an FXYD protein that binds to the sodium=potassium exchanger ATPase on the plasma membrane (Crambert et al., 2002). Using our method, these TM proteins were predicted to bind SERCA (see Table 3).

3.5.2. Negative controls

We also identified high-abundance fragments of cytosolic proteins in our ER fraction by mass spectrometry, which were likely contaminants from sample preparation. These fragments were associated with components of the sarcomere such as Troponin C (TNNC1), the myosin light chains 1 and 3 (MYL1, MYL3) and actin (ACTA1). Although the TM proteins were correctly predicted, the cytosolic proteins were initially also predicted to bind as well. We expanded the sequence to include up to twenty residues flanking the original fragment; for the TM proteins, the extensions contained sequences like CLILICLLLI that are associated with fragments that embed into membrane bilayers.

In addition, after visually inspecting sequence properties such as charge density and amino acid type using the interactive notebook manual_select.ipynb, we refined the prompt to account for features unique to positive controls, such as the presence of consecutive hydrophobic residues. Interestingly, upon asking the LLM to suggest additional sequence patterns that differentiate positive from negative controls, it proposed the sequence of R followed by K or R. We find the recommendation plausible, given the established role of RR in the localization of phospholamban in the endoplasmic reticulum (Sharma et al., 2010) and the motifs RXR and KKXX for the localization of other peptides (Shikano and Li, 2003). Altogether, the refined attributes are consistent with the insertion of the sequence into the hydrophobic interior of a lipid bilayer and the stability of electrostatic interactions with negatively charged phosphate groups on the membrane surface. To reflect these observations, we appended to our prompt the statement

We observe that sequences with an output of 1
have several consecutive hydrophobic residues and the sequence RR.

After tuning the prompt, the negative controls were correctly predicted as not binding, while the positive controls maintained their correct predictions.

3.5.3. Full set of fragments

Lastly, we applied the method and llama3:70b/gte-small combination to the remaining upregulated fragments in the data set (see Table 4). We specifically narrowed the set to those that were determined to reside in the ER membrane, based on Uniprot annotations. Examples of hits predicted to bind include cytochrome P450 2J2 (P51589), ribosomal protein L26 (P62854), 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Q15125), Selenoprotein S (Q9PQEV) and dolichol-phosphate mannosyltransferase 1 (Q9P2X0). The predicted binders all serve established roles in the ER. Cytochrome P450 2J2, a key enzyme expressed in cardiac cells and bound to the endoplasmic reticulum membrane, plays a crucial role in detoxification and metabolism processes (Zhao et al., 2021). Furthermore, ribosomal protein L26, a component of the large ribosomal subunit, is located in the rough ER and is involved in protein synthesis (Scavone et al., 2023). 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase, a transmembrane protein embedded in the ER membrane and involved in cholesterol biosynthesis, specifically facilitates a critical step in cholesterol formation(Silvente-Poirot and Poirot, 2012). Other proteins with different functions include Selenoprotein S, a membrane protein that incorporates selenium into its active site, thus protecting cells from oxidative damage(Liu et al., 2013), and Dolichol-phosphate mannosyltransferase 1, an ER-associated enzyme involved in N-glycan biosynthesis and protein quality control(Maeda, 2000). Importantly, these predictions show that our strategy for prompting an LLM with sequence-specific training data generalizes to novel fragments not found in our training set.

3.6. Limitations

Our approach has several limitations that warrant further refinement. The most significant one is that our small data set size likely challenges the generalization of this LLM approach to diverse protein sequences that have little homology to the training data. Hence, a bias is introduced into the LLM approach from the input/output training sequences that we generated from our cloning data. Naturally, this will likely miss functionally relevant sequences that were not part of cloned peptides, although this concern is mitigated somewhat by our successful testing against control sequences. It is also possible that our approach may have missed important sequence motifs within transmembrane regions of the proteins that determine SERCA binding. This is because the broad set of protein fragments identified by mass spectrometry tended to be from fragments that are exposed to the cell cytosol, whereas we generally did not observe protein domains likely to be embedded in lipid bilayers.

The current implementation considers a basic feature set for protein fragments. Including more details such as the predicted secondary structure (Kabsch and Sander, 1983) and annotating known functional motifs, such as sequences rich in asparigine, leucine, and isoleucine that typically bind to SERCA (Alford et al., 2020), could potentially improve the performance of the LLM approach. Annotation of sequences that have ER retention motifs like RR may also be helpful in this regard. Lastly, expanding the data by incorporating external APIs for structure prediction and protein-protein interactions could be beneficial (Abramson et al., 2024).

In terms of the LLM models used, there are many limitations to consider. One of these is the limited size of each LLM’s context window, which restricts the extent of chain-of-thought prompting that can be done. In addition, the quality of the prompt used for the LLM s was an important determinant of obtaining sensible responses. For example, our experiments with Microsoft’s phi3 medium LLM model were largely unsuccessful in generating interpretable responses, despite our efforts to guide its interpretation of our data and the formatting of the replies. Along these lines, it is expected that each new model that is used in our framework will need some prompt tuning to obtain coherent responses and accurate predictions. Even after tuning the models, each model is intrinsically non-deterministic in its responses, which can add variability to its classification of trial sequences. However, questions that prompt the LLM to explain its reasoning might provide valuable insight toward optimizing prompts. Moreover, combining LLMs with human-interpretable models (Bordt et al., 2024) could be a promising strategy to guide this process. Lastly and on a pragmatic note, we used ollama and langchain to implement our approach; these utilities and libraries are in a rapid stage of development, thus some features become obsolete with time and require some code updating.

4. Conclusions

This study explored the use of LLMs to predict the in vivo behavior of peptide fragments based on their sequences. A RAG database was created using peptide sequences with experimental characterization of SERCA binding. This database was used to train an LLM to predict the SERCA binding potential of the control and new peptide fragments. The results demonstrate the potential of LLMs, coupled with RAG, to accurately predict SERCA binding based on peptide sequence alone. This approach, although trained on protein fragments isolated from cardiac cells, is expected to generalize to other proteomic data comprising primary sequences. Further investigation into diverse protein datasets and additional sequence features may enhance the accuracy and applicability of this LLM-based approach. Using these data, it may be feasible to extend the binary classification of SERCA binding to instead predict fragment/SERCA binding affinities.

5. Tables

Table 1. Cloned sequences and representative fragments. One additional fragment each for P0DJ93, Q15836, Q9BV81, and Q9P0S9 was identified, but not included in this table. These fragments are available in the github repository. Structures of representative examples are in Fig. 4

Protein	Name	Sequence	Binds?	Accession #
TMEM50A	Transmembrane protein 50A	RGDSYSEGCLGQTGARI	Y	O95807
SMIM13	Small integral membrane prot. 13	RRAPADEGHRPLT	Y	P0DJ93
VAMP3	Vesicle-associated membrane prot. 3	RRLQQTQNQVDEVVDIMRV	Y	Q15836
VAMP8	Vesicle-associated membrane prot. 8	RNLQSEVEGVKN	Y	Q9BV40
SEC61B	SEC61 translocon subunit beta	RFYTEDSPGLKV	Y	S4R3B5
EMC6	ER membrane prot. complex subunit 6	REGPPFISEAAVRG	N	Q9BV81
TMEM14C	Transmembrane protein 14C	KVGVSMFNRPH-	N	Q9P0S9

Table 2. Performance (F1 scores) with respect to embedding functions and LLMs available on HuggingFace. The reported standard deviation is based on N=5 trials. Below these trials, we show different model configurations, including appended features, numbers of clusters, clustering versus random, and I/O pairs. ^∗ noragscore. These were computed using a high-performing model/embedding pair as a reference case (e.g. llama3:70b/e5-small-v2). clusterSequences=False entails randomly selecting points as opposed to choosing from clustering of rag scores. iopairPrompt=NoFasta signifies omitting fasta sequence data and relying solely on attributes for chain of thought prompting.

Embeddings	LLM models
	llama2:70b	llama3:8b	llama3:70b	gemma2:27b
e5-small-v2	$0.63\pm 0.03$	$0.88\pm 0.05$	$\mathbf{0.96\pm 0.06}$	$0.85\pm 0.12$
bge-small-en-v1.5	$0.61\pm 0.10$	$0.59\pm 0.34$	$0.92\pm 0.07$	$0.96\pm 0.05$
gte-small	$0.74\pm 0.16$	$0.48\pm 0.33$	$0.94\pm 0.05$	$0.88\pm 0.07$
protein-matryoshka	$0.90\pm 0.13$	$0.77\pm 0.29$	$0.86\pm 0.11$	$0.88\pm 0.12$
snowflake-arctic-	$0.47\pm 0.35$	$0.74\pm 0.30$	$0.99\pm 0.02$	$0.91\pm 0.11$
embed-xs
Features	LLM model
reference			$\mathbf{0.96\pm 0.06}$
ragScore only			$0.89\pm 0.05$
2o attributes∗			$0.95\pm 0.06$
no features			$0.96\pm 0.03$
nClusters=10			$0.95\pm 0.05$
clusterSequences=False			$0.66\pm 0.26$
iopairPrompt=NoFasta			$0.86\pm 0.04$

Table 3. Positive and negative controls Fragments were selected from the MS data for evaluation by the best performing LLM parameterization. Fragments were derived from two transmembrane protein peptides (PLN and FXYD1) and several sarcomeric proteins (TNNC1, MYL1, MYL3, ACTA1). TNNC1 and MYL3 had several fragments. Each fragment was flanked by several amino acids on each terminus. Prompt is in Sect. 3.5.2.

Protein	Name	Fragment	Binding
			prediction
PLN	Cardiac phospholamban	RRASTIEMPQQARQ	Y
FXYD1	Phospholemman	RTGEPDEEEGTFRS	Y
TNNC1	Troponin C, slow skel./card.	KIMLQATGETITEDDIEELMKD	Y
MYL1	Myosin light chain 1, skeletal	KMKEEEVEALMAGQEDSNGCINYEAFVKH	N
MYL3	Myosin light chain 3	RLTEDEVEKLMAGQEDSNGCINYEAFVKH	N
ACTA1	Actin, alpha skeletal	KDLYANNVMSGGTTMYPGIADRM	N

Table 4. Other upregulated candidates Example predicted binders identified from set of upregulated fragments, using the default LLM parameterization. Selected one fragment from each hit.

Protein	Name	Fragment	Binds?
CYP2J2	Cytochrome P450 2J2	KGTMILTNLTALHRD	Y
RPS26	Ribosomal Protein L26	RDISEASVFDAYVLPKL	Y
EBP	3-beta-hydroxysteroid-Delta(8),	KHLTHAQSTLDAKA	Y
	Delta(7)-isomerase
MMGT1	EMC5	KGLVGIGLFALAHAAFSAAQHRS	N
SELENOS	Selenoprotein S	RAAAAVEPDVVVKR	Y
DPM3	Dolichol-phosphate	RVATFHDCEDAARE	Y
	mannosyltransferase 3
EMC6	ER membrane protein 6	RGNAAVLDYCRT	N

6. Figures

Figure 1. Our Retrieval augmented generation (RAG)/large language model (LLM)schematic for analyzing proteomics data in this study.

Figure 2. Protein fragment characteristics A. Numbers of amino acids in sequences that bind (traffic, blue) or do not bind (notraffic, orange) SERCA. B. Histogram of peptide lengths as a percentage of the total pool. C. Histogram of peptide absolute charge densities in absolute numbers. . fragments.ipynb

Figure 3. Clustering results UMAP results for a representative training set labeled according to A. binding (1, blue)/nonbinding (0, red) status. B. Cluster assignments from A. by color. Points with black edges denote members of the binding class. X- and Y- axes correspond to the projected UMAP coordinates. C. Rank order of selected clusters by size. . outputted by umapPrompter.py

Figure 4. Protein structures with cleaved fragments TMEM14C (PDB code 2LOS (Kabsch and Sander, 1983)), EMC6 (Alphafold accession (Jumper et al., 2021)), TMEM50A (Alphafold accession O95807), and SMIM13 (Alphafold ccession P0DJ93) are shown as ribbons colored according to amino acid type (polar, green; apolar, white; negatively-charged, red; positively-charged, blue). Fragments identified via MS are identified with black arrows. . on uniprot

Appendix A Supplementary

A.1. Sample prompts

• Ex 1. The sequence ’xxxx’ with numerical attributes x,y,z is predicted to bind SERCA. Based on this information, would the sequence ’yyy’ with numerical attributes u,v,w bind SERCA and why?

A.2. Equations

We define the Shannon entropy as

(1) $$E(p)=-p\;\log 2(p)+(1-p)\;\log 2(1-p)$$

where $p$ is the percentage of points with output=1.

The centroid hydrophobicity quantifies the clustering of hydrophobic residues around the midpoint of a sequence, under the assumption that sequences rich in hydrophobic residues will embed in the ER bilayer. This is calculated using the equation:

(2) $$c_{h}=\frac{1}{2\delta}\sum_{j=i-\delta}^{i+\delta}h_{j}$$

Here, $i$ represents the position of the central residue, and $h_{j}=1$ if the residue at position $j$ is hydrophobic and $0$ otherwise.

Similarly, the charge density is evaluated by counting the number of D (Aspartic acid), E (Glutamic acid), K (Lysine), and R (Arginine) residues, and then dividing this sum by the total number of residues in the sequence.

Table 5. Parameters used . Refer also to Sect. A.3.1

Parameter	Description
Token length	Length of tokens used for processing
Chunks	Size of data segments for processing
Overlap	Overlapping amount between consecutive chunks
Numbers of clusters	Number of clusters in the data
nInputOutputPairs	Number of input-output pairs for training

A.3. Inputs

A.3.1. Yaml parameter files

Below is an example yaml file used for this study.

modelType: llama3:70b
embedding_model: thenlper/gte-small
chunk_size: 100
chunk_overlap: 0
dbPath: "/data/pkekeneshuskey/db/huggf_db_seq"
srcPath: "../sequences/training.txt"
testPath: "../sequences/100"
chunkByLine: True
testing: False
manual: False
nClusters: 5
nPromptsWanted: 10
appendFeatures: True
prompt:  >
  <s> [INST]
  Each line in the provided context contains one input, a sequence of A,C,D,E,F,G,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y,0, and 1, several numbers, as well as one output digit.
  [/INST] </s>
  [INST] Question: {question}
  Context: {context}
  Answer: [/INST]
query:
  - Will be provided.

A.3.2. Testing with controls

Prompt for testing controls:

I have a list of input/output pairs, where the input includes an amino acid sequence, a score,
a length, and a hydrophobicity score, and the output is 1 or 0 if it binds a target protein.
We also observed that output 1 sequences have adjacent RR residues in the FASTA input.
Input: RNVYVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH0,0.064,54,0.1  Output: 0;
Input: MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATGGILGLTGLY1,0.065,51,0.1  Output: 0;
Input: GVIATIAFLMINAVSNGQVRGDSYSEGCLGQTAARIWLFVGFMLAFGSLIASMWI0,0.072,56,0.1  Output: 1;
Input: MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGAT0,0.060,41,0.2  Output: 0;
Input: MEEASEGGGNDRVRNLQTEVEGVKNIMTQNVERILARGENLEHL1,0.043,45,0.3  Output: 1;
Input: MWRFYTEDSPGLKVGPVPVIVMSLLFIASVFML1,0.045,34,0.1  Output: 1;
Input: SGKFMPAGLIAGASLLMVAKVGVSMFNRPH1,0.056,31,0.1  Output: 0;
Input: SETEEDTSSSPHRIRSARQRRAPADEGHRPLS1,0.030,33,0.4  Output: 1;
Input: MSTGPTAATGSNRRLQQTQNQVDEVVDLMRVNVDKVLERDQKLSELDDRA0,0.051,51,0.3  Output: 1;
Input: IMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVAKKFWWKNVKMIVL1,0.054,55,0.3  Output: 1;
Based on the provided inputs and outputs, predict the output of the following inputs. Please write only your predicted output as the sequence and integer on its own line, terminated with a semicolon, such as ’Sequence1 Output: 1;’ or ’Sequence 1 Output: 0;’ Make your best guess if you don’t know:
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLI,0.114,45,0.2 ;
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLI,0.114,45,0.2 ;
LGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR,0.137,43,0.4 ;
RCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMK,0.130,56,0.4 ;
DDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQE,0.129,58,0.3 ;
GNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI,0.117,52,0.2 ;
KIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGT,0.119,48,0.3 ;
TQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKE,0.122,56,0.3 ;
ELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS,0.135,44,0.3 ;
AGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP,0.139,61,0.2 ;
SAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP,0.135,62,0.2

Src	Seq	Binding?	Protein
P26678	RRASTIEMPQQARQ	Y	PLN
–	RASTIEMPQQARQ	Y	PLN
O00168	RTGEPDEEEGTFRS	N	FYKD1
P63316	KIMLQATGETITEDDIEELMKD	N	TNNC1
P63316	KAAVEQLTEEQKNEFKA	N	TNNC1
P08590	KLMAGQEDSNGCINYEAFVKH	N	MYL3
P08590	KNKDTGTYEDFVEGLRV	N	MYL3
P68133	KDLYANNVMSGGTTMYPGIADRM	N	ACTA1
P68133	RKDLYANNVMSGGTTMYPGIADRM	N	ACTA1

Table 6. Phenotypic Sequences and Associated Proteins

Appendix B Online Resources

Source code in support of this study will be made available at https://github.com/huskeypm/pkh-lab-analyses. A colab notebook demonstrating the RAG concept (Sect. 2.2)is also provided.