myenvcntequation \newaliascntmytheoremcntmyenvcnt \newaliascntmylemmacntmyenvcnt \newaliascntmycorollarycntmyenvcnt \newaliascntmypropositioncntmyenvcnt \newaliascntmydefinitioncntmyenvcnt \newaliascntmyremarkcntmyenvcnt
A hyper-Kähler metric on the moduli space of monopoles with arbitrary symmetry breaking
Abstract.
We construct the hyper-Kähler moduli space of framed monopoles over for any connected, simply connected, compact, semisimple Lie group and arbitrary mass and charge, and hence symmetry breaking. In order to do so, we define a configuration space of pairs with appropriate asymptotic conditions and perform an infinite-dimensional quotient construction. We make use of the b and scattering calculuses to study the relevant differential operators.
1. Introduction
1.1. Background and overview
Monopoles over with gauge group have been studied quite extensively. When a finite energy condition is imposed, their behaviour near infinity is determined, up to a certain order, by the charge, which is given by a single integer [JT80]. If we fix a value of this charge, and further fix a framing for the monopoles of that charge, then we can form moduli spaces which are complete hyper-Kähler manifolds whose dimension is four times the charge [AH88]. The metric is inherited from the norm.
For more general gauge groups, however, the picture is more complicated. Here, the charge is not longer given by a single integer, and the mass takes on a more prominent role, determining the symmetry breaking. This complicates the analysis involved and new features arise which were not present in the case of .
Nonetheless, these monopoles and their moduli spaces have also been studied. Often, this has been through equivalences between them and other mathematical objects. For example, Nahm’s equations have been used to study -monopoles with maximal symmetry breaking [Hur89, HM89, Bie98] and -monopoles with non-maximal symmetry breaking [Dan92], and to produce some -monopoles with non-maximal symmetry breaking [CN22]. Rational maps have also been used to study these moduli spaces, which in the case of non-maximal symmetry breaking can be organised into stratified spaces [Mur89, Jar98, Jar98a, Jar00, MS03].
To be more precise, the case of non-maximal symmetry breaking involves two different types of charges: magnetic and holomorphic. The magnetic charges provide discrete topological information about the asymptotics of the monopoles. However, the moduli space of monopoles with a given magnetic charge can be further broken down into strata corresponding to different holomorphic charges. These strata are in fact fibrations, where each fibre is the moduli space corresponding to a specific framing represented by a point in the base.
Our aim is to construct these moduli spaces without relying on any of the above equivalences, using the analytical framework developed by Kottke [Kot15], which was already used by the same author to explore the case of -monopoles over other -manifolds [Kot15a]. This approach provides the structure of a hyper-Kähler manifold, and establishes some analytical tools with which to investigate further properties of the metric.
One of the main ideas of this framework is to treat different subbundles of the adjoint bundle separately. More specifically, at each fibre of the adjoint bundle we consider the Lie subalgebra which commutes with the mass term, and its orthogonal complement. At the level of subbundles, the adjoint action of the Higgs field will degenerate along the former but not the latter, causing the relevant differential operators to have different properties and hence require different tools.
Once the analysis is set up, the necessary infinite-dimensional quotient construction is similar to that of other studied problems, like the case of anti-self-dual Yang–Mills connections laid out in Donaldson’s and Kronheimer’s book [DK90].
Similar techniques were applied by Sánchez Galán to the construction of moduli spaces of -monopoles [Sán19].
Note that, in the case of non-maximal symmetry breaking, we must fix the magnetic and holomorphic charges in order to maintain the finiteness of the metric. Hence, the resulting moduli spaces will be the fibres of the different strata.
Although we will indicate in some places the correspondence with previous work, we will establish the necessary concepts surrounding monopoles ab initio, including convenient notions of mass, charge and framing.
We begin by introducing monopoles in Section 2. We furthermore construct a model which has the asymptotic behaviour we expect of a monopole of a given charge and mass, and we study the adjoint bundle in relationship to this model. We then explain what we mean by framed monopoles of the given mass and charge, as well as the corresponding moduli space. Our definitions differ somewhat from other approaches in the literature, but are better suited to our construction.
In Section 3 we start by looking at the linearised operator involved in the moduli space construction. This serves as motivation to introduce the analytical tools of b and scattering calculuses which provide the necessary framework to formally set up our moduli space construction.
We then study the linearised operator in more detail in Section 4 using this analytical framework, proving that it is Fredholm and surjective and computing its index.
Lastly, in Section 5 we complete the construction of the moduli space. This involves applying the properties of the linearised operator to carry out the infinite-dimensional quotient. We then see how the construction can be viewed as a hyper-Kähler reduction, which provides a hyper-Kähler metric. We finish by discussing our resulting moduli spaces in the context of some specific cases.
The main result is Subsection 5.4, which states that the moduli space of framed monopoles for any mass and charge is either empty or a smooth hyper-Kähler manifold of known dimension.
1.2. Notation
Our setting throughout is a principal -bundle over Euclidean , where is any connected, simply connected, compact, semisimple Lie group. We denote the Lie algebra of as .
We will write for the automorphism bundle, whose fibres are the automorphism groups of each of the fibres of . The group of automorphisms, or gauge transformations, of the bundle will be written as . We have
We write for the adjoint bundle, whose fibres are Lie algebras associated to the fibres of the automorphism bundle.
Although we write for the space of sections of a bundle , these might not necessarily be smooth. The appropriate regularity and asymptotic conditions for each case will be made precise later on.
Note that from the Killing form we can obtain a bi-invariant Riemannian metric on and an -invariant inner product on . Combining this with the Euclidean metric on , the bundles of -valued -forms acquire an inner product on their fibres. Together with the Euclidean measure on the base manifold, this will allow us to define Lebesgue spaces and Sobolev spaces on the spaces of -valued -forms.
2. Monopoles and framing
We start by defining monopoles. We then discuss the mass and the charge and establish an asymptotic model for a choice of them. Lastly, we briefly explain how to use this will be used to set up the moduli space problem.
2.1. Monopole definition
We construct monopoles over using the principal -bundle described above. In particular, we consider pairs in the following space.
Definition \themydefinitioncnt.
The configuration space is
where denotes the space of principal connections on . If , we refer to and as the connection and the Higgs field of the configuration pair.
On this space, we define the Bogomolny map
and the energy map
Monopoles are then defined inside this space.
Definition \themydefinitioncnt.
We say that is a monopole if it satisfies the Bogomolny equation
and it has finite energy, that is,
Note that the group of gauge transformations of acts on configuration pairs . The resulting action on the connection is the usual one and the action on the Higgs field is the fibrewise adjoint action.
With respect to this action, the Bogomolny map is equivariant ( also acts fibrewise on the codomain ), and the energy map is invariant. This means that the gauge transformation of a monopole is still a monopole. This gives rise to the the idea of the moduli space of monopoles as a space that parametrises monopoles modulo gauge transformations.
Note that, with an appropriate choice of the space of sections, will be an infinite-dimensional Lie group. Then, its Lie algebra will be given by the corresponding space of sections of the adjoint bundle, that is,
Lastly, let us state a pair of formulas which will be useful for us later on.
Proposition \themypropositioncnt.
The derivative of the Bogomolny map at a point is given by
for any .
If is a Lie group, the infinitesimal action of an element is given, at a point , by
Remark \themyremarkcnt.
Monopoles can be viewed as a dimensional reduction of anti-self-dual Yang–Mills connections: if a connection on is invariant in one direction, and we rename the connection matrix in this direction as the Higgs field, the Bogomolny map applied to the resulting connection on with this Higgs field represents the self-dual part of the curvature of the original connection.
This relationship becomes apparent throughout the study of monopoles. For example, some expressions involving the connection and Higgs field of a configuration pair can be viewed as a simpler expression involving the corresponding connection on , and many of the tools used have their counterparts in the study of connections on dimensions.
2.2. Mass and charge, the model, and the adjoint bundle
In the case of , we know that the finite energy condition implies the existence of a mass and a charge, which determine the monopoles’ asymptotic behaviour, but in the general case this picture is not necessarily so clear. This means that often an additional asymptotic condition is imposed, of the form
(2.2.1a) | ||||
(2.2.1b) |
in some gauge along rays from the origin, for some , called the mass and the charge, respectively. Here, is the radial variable and the -form is, hence, the area form of spheres centred around the origin. The terms represented by the dots are lower order terms which vary in their definitions.
However, our approach is to not only impose such asymptotic conditions for some gauge, but to actually fix a model for this asymptotic behaviour and then to require our monopoles to be close enough to this model. This will have some benefits, as explained in Subsection 2.3, and will allow us to set up the moduli space construction.
Hence, for a mass and a charge , both in , our aim is to construct a model pair that, near infinity, satisfies the Bogomolny equation and has exactly the form
(2.2.2a) | ||||
(2.2.2b) |
in some gauge along any ray from the origin.
To do this, we start by observing that these conditions imply that the mass and the charge must commute, so we can find a maximal torus inside whose Lie algebra contains and . We will firstly build our model on a principal -bundle and then carry it over to a principal -bundle through an associated bundle construction.
Now, since is Abelian, the adjoint bundle of any principal -bundle is trivial, and hence can be identified with . Furthermore, any principal connection on the principal -bundle induces the trivial connection on its adjoint bundle. In particular, we can define constant sections, like and , which are equal to and everywhere and furthermore are covariantly constant with respect to any principal connection.
Additionally, if we have the extra integrality condition , we can build a principal -bundle on the unit sphere whose curvature is . Extending this bundle and connection radially to we obtain a principal -bundle which we call . The connection, which we call , satisfies the curvature condition
Considering the identification as bundles over , we can construct
as an element of . Since the constant sections are covariantly constant with respect to , it is straightforward to check that the pair satisfies the Bogomolny equation over .
Now, since is a subgroup of , we can associate to a principal -bundle (over ). We can carry the pair over to through this construction. But since is simply connected, must necessarily be trivial over , and hence we can extend it to . The pair can be extended smoothly over the origin as well, modifying it if necessary inside the unit ball and leaving it unchanged elsewhere. This yields a pair over , which is hence in .
Definition \themydefinitioncnt.
We refer to the pair constructed above as the asymptotic model pair of mass and charge , and we write it as
Note that this asymptotic model pair still satisfies the Bogomolny equation near infinity, but not necessarily near the origin. This is not a problem, since we only want to use it to study the behaviour of our monopoles near infinity. However, defining it over the entire will make some notation simpler.
It will be easy to understand the behaviour of this pair, and hence of our monopoles, if we decompose the adjoint bundle appropriately. In order to do this, near infinity, we perform a root space decomposition of each fibre of the complexification of the adjoint bundle , with the maximal Abelian subalgebras given by the fibres of . We refer to each of the resulting subbundles as root subbundles, which will be denoted by for each in the space of roots of . The bundle of maximal Abelian subalgebras will simply be written as .
We can summarise the constructions of this subsection in the following proposition.
Proposition \themypropositioncnt.
Let be such that and , and let be a maximal Abelian subalgebra of containing and .
Then, we can construct a principal -bundle over Euclidean whose adjoint bundle can be decomposed near infinity as
(2.2.3) |
such that the adjoint action on the adjoint bundle behaves under this root subbundle decomposition in the same way as it would behave under the analogous root space decomposition, that is, if and , then
Furthermore, this can be done in such a way that there exists a smooth asymptotic model pair , which, near infinity, satisfies the Bogomolny equation as well as
(2.2.4a) | ||||
(2.2.4b) |
where are constant sections in (the real part of) the first summand of the decomposition.
The subbundle in the decomposition is obviously trivial, but we can also relate the other terms to simple line bundles. We denote a complex line bundle of degree over the -sphere, with its homogeneous connection, by . We can extend it radially to , where we refer to it also as .
Corollary \themycorollarycnt.
The asymptotic model pair decomposes along the root subbundle decomposition. In particular, on each complex line bundle , the pair satisfies
(2.2.5a) | ||||
(2.2.5b) |
Therefore, by restricting the connection to each subbundle we have
Remark \themyremarkcnt.
Notice that, although is not defined as a root of the Lie algebra, for most purposes we can write as copies of . By this, we mean that substituting by in results about subbundles will yield the analogous results for . We will follow this convention from now on.
2.3. Framed monopoles
One of the key ideas in the construction of moduli spaces of monopoles is to study framed monopoles. This means that we fix not only the mass and the charge, but also the specific asymptotic behaviour, allowing only gauge transformations which tend to the identity at infinity.
In our case, this will be achieved by defining the configuration space for a given mass and charge as the space of pairs which differ from the asymptotic model pair by a decaying element of a Banach space. This guarantees that the asymptotic behaviour is the same up to a certain order, and it provides a Banach structure to be able to apply the necessary analysis.
The group of gauge transformations will then be modelled on a related Banach space, so that its Lie algebra also consists of decaying sections of the adjoint bundle.
The specific form of these Banach spaces will be discussed at the end of the next section.
3. Analytical framework
The first step towards the construction of the moduli space is to look at the linearised problem, and more specifically at the linearised operator made up of the linearised Bogomolny equation together with a gauge fixing condition.
The specific shape of this operator will motivate the introduction of the b and scattering calculuses, whose combination is particularly well suited to the study of this problem and will provide the analytical framework for the moduli space construction. The b calculus is analogous to the analysis on cylindrical ends studied in other works [Can75, LM85], whereas the scattering calculus in this case is simply the typical analysis on . However, this formulation offers a convenient setup for our problem.
In Subsections 3.2, 3.3, 3.4 and 3.5 we summarise the most relevant analytical definitions and results for these calculuses, which can be combined to define hybrid Sobolev spaces. Most of this analytical framework is obtained from Kottke’s work [Kot15] and references therein, including Melrose’s works [Mel93, Mel94], which contain a more detailed account.
We then choose the specific spaces which will be appropriate for our case, explain some of their properties and formally set up the moduli space construction.
3.1. The linearised operator
As stated above, the first part of the linearised operator is the derivative of the Bogomolny map
On the other hand, the action of the infinitesimal gauge transformations is
so we can consider the formal adjoint of this map, that is,
whose kernel will be orthogonal to the orbits. Pairs in this kernel are said to be in Coulomb gauge with respect to .
Putting both of these together (and changing the sign) we obtain the following operator.
Definition \themydefinitioncnt.
Let . We define its associated Dirac operator as
(3.1.1) |
acting on the space of sections
We view this as a Dirac operator by using the isomorphism
where is the spinor bundle on . Indeed, considering the Clifford action only on the first factor, the resulting associated Dirac operator will be precisely the first summand of (3.1.1). In our case, the second spinor bundle can simply be written as . In other words,
where is the Dirac operator associated to the connection on , which acts on the space of sections
Note how the Dirac operator notation is related to the interpretation of configuration pairs as the dimensional reduction of connections on , as explained in Subsection 2.1.
The characterisation of as a Dirac operator will allow us to write it out in a more convenient form. To do so, note that if for some mass and charge , then
where acts through Clifford multiplication on the factor with its component and through the adjoint action on the factor with its component, and acts similarly through the adjoint action. Hence, we will actually write out and use the above formula to understand the operator for other configuration pairs of the given mass and charge.
Now, near infinity, and decompose along the root subbundle decomposition (2.2.3), so the operator will be made up of the diagonal terms
(3.1.2) |
where represents the Dirac operator on the line bundle .
Therefore, we can characterise the behaviour of the linearised operator near infinity in the following way.
Proposition \themypropositioncnt.
The operator decomposes near infinity as
which acts on sections of the bundle
Furthermore, if , then
will be a bundle endomorphism proportional to .
We can notice that the expression for , when , is like the one needed to apply Callias’s index theorem, since it is a Dirac operator plus a skew-Hermitian algebraic term which doesn’t degenerate at infinity. However, when , this last condition is not satisfied, since the Higgs field tends to at infinity.
Therefore, in the next few subsections, we introduce two separate formalisms which are suited to these two circumstances. These are the b calculus, which will help us study the case where , and the scattering calculus, which will provide a convenient rewording of the setup of Callias’s index theorem for the case . We will then see how these two formalisms fit together to study our linearised operator.
3.2. B and scattering calculuses
The basic setting for the b and scattering calculuses is a compact manifold with boundary , together with a boundary defining function , that is, a smooth non-negative function which is precisely on the boundary and such that is never zero on the boundary .
Definition \themydefinitioncnt.
We define the spaces of b and scattering vector fields as
and
respectively, where is the space of vector fields on .
These spaces of vector fields can also be regarded as sections of certain bundles over , the b and scattering tangent bundles, denoted by and . There are natural maps
which are isomorphisms in the interior of (but not on the boundary). Near a point on the boundary, if are local coordinates for around this point, then
and
are local frames for and , respectively. Sections of the corresponding cotangent bundles (that is, the duals of the tangent bundles), will be the b and scattering -forms. Analogously, near the boundary, these bundles have local frames and .
It is important to note that the spaces and form Lie algebras with the usual Lie bracket for vector fields, and that, furthermore, we have .
Like with the usual vector fields, we can also define differential operators. In order to do so, assume that is a vector bundle on with a connection whose covariant derivative is given by .
Definition \themydefinitioncnt.
We define the spaces of b and scattering differential operators of order on as
and
respectively, where a composition of derivatives is simply taken to mean a section of the endomorphism bundle.
3.3. B and scattering Sobolev spaces
In order to define Sobolev spaces, let us assume that the vector bundle carries an inner product. Furthermore, suppose that we have an exact scattering metric on , by which we mean a metric on the interior of which can be written as
near , where defines a metric on the boundary. This is a metric on the scattering tangent space, and also provides a measure on .
The definition of Sobolev spaces for the b and scattering calculuses is then analogous to the usual Sobolev spaces. Two additional features will be useful: adding weights to the Sobolev spaces, and combining b and scattering derivatives in the same space. The following definition encompasses these ideas.
Definition \themydefinitioncnt.
Let , and . We define the Sobolev spaces
(3.3.1) |
We also write
When there is only one kind of derivative present, we may omit the corresponding subscript and superscript. The weight and the bundle may also be omitted when trivial.
Remark \themyremarkcnt.
Note that the ordering of the first three terms in the expression in (3.3.1) does not matter, as can be shown by looking at the commutators of the appropriate operators.
Remark \themyremarkcnt.
These are Banach and Hilbert spaces with respect to their natural norms, and we note that smooth compactly supported functions are dense in these spaces when .
In fact, we can also define pseudodifferential operators and Sobolev spaces of negative order, and these will be briefly mentioned later on, but we will not give details about it here.
Now, it will be useful to have some embedding results between these Sobolev spaces.
From the definitions we see that we can exchange b and scattering derivatives.
Lemma \themylemmacnt.
We have
Furthermore, we can also consider the usual Sobolev embeddings adapted to our situation.
Consider firstly the interior of the manifold with our given scattering metric. The usual Sobolev spaces on this Riemannian manifold are precisely the spaces that we defined with scattering derivatives.
Furthermore, consider again the interior of , but with our metric weighted by . Then, the resulting Sobolev spaces on this new Riemannian manifold are precisely the spaces that we defined with b derivatives, where the weight takes into account that the underlying measure is also weighted by .
Let us assume that we can apply the Sobolev embedding theorems to these two Riemannian manifolds. Then, we can obtain similar Sobolev embedding theorems for our b and scattering Sobolev spaces (taking into account the weighted measure).
Clearly, we can also obtain an embedding of a Sobolev space into one with lower weight (all other parameters being equal), but we can also combine this with the Sobolev embeddings to obtain compact embeddings.
This is captured in the following proposition, where is taken to mean that there is a continuous inclusion between the spaces.
Lemma \themylemmacnt.
Assume that
(3.3.2a) | ||||
(3.3.2b) | ||||
(3.3.2c) | ||||
(3.3.2d) |
Then,
and
Furthermore, if , then the embeddings are compact.
Remark \themyremarkcnt.
If we have an embedding
then we also have the embedding
where and . This is a consequence of the properties noted in Subsection 3.3.
3.4. Polyhomogeneous expansions
Another important collection of spaces are those of polyhomogeneous functions.
We say is an index set if it is discrete, satisfies when for a sequence in , and furthermore, satisfies
Then, we say that a function, or a section of a vector bundle, on has a polyhomogeneous expansion with index set if is asymptotic to the sum
at , for some choice of which are smooth up to the boundary. Here, by asymptotic we mean that, for any ,
is times differentiable, and it and its first derivatives vanish to order at the boundary.
We will be mostly concerned with a specific subset of these.
Definition \themydefinitioncnt.
Let . Then, we define the space
of sections of which are bounded polyhomogeneous of order as the space of polyhomogeneous sections whose index sets satisfy .
Furthermore, will denote the space of sections which vanish with all derivatives to infinite order.
If a section is in , we simply say it is bounded polyhomogeneous.
It is important to note that b operators preserve the order of bounded polyhomogeneous sections, and hence scattering derivatives increase the order by .
3.5. Fredholm theory
In the b and scattering calculuses there are results which allow us to prove that certain operators are Fredholm and to compute their index. We will briefly summarise them, since the main notions will reappear when we combine both calculuses to study our operator.
In the case of the scattering calculus, the relevant notion is Callias’s index theorem [Cal78, Kot11]. Suppose that is odd dimensional, and that we have an operator , where is a Dirac operator for the scattering metric and is an algebraic, skew-Hermitian term which is non-degenerate on the boundary of and commutes with the Clifford action on the bundle . Then, the operator is Fredholm as a map
for any .
To find its index (which is independent of ), consider the restriction of to . Now consider the subbundle given by the positive imaginary eigenspaces of the endomorphism . This, in turns, splits as as the eigenspaces of . If denotes the Dirac operator mapping to induced by , then
Furthermore, any element in the kernel of this operator will be in .
In the b calculus, the situation is a bit more involved. Suppose we have an elliptic operator of order which, near the boundary, can be written as
where represents coordinates on the boundary and is a multi-index. Now, consider the family of operators on the boundary given, for a parameter , by
These operators will be elliptic on , and they will give us information about the operator at the boundary. In particular, define the b spectrum of the operator as
which is a discrete set. We call the real parts of its elements indicial roots.
For a value , elements represent sections near the boundary of which are of the form and asymptotically satisfy . In fact, we can also define the order of , which represents the existence of asymptotic solutions of the form
In our case, this order will always be , so we will not go into more details.
In this setting, the operator is Fredholm as a map
as long as is not an indicial root, that is, .
The index of the operator might change depending on the weight of the Sobolev spaces. However, there are two properties which can be useful for its computation:
and, if , then
Lastly, when the spectrum is real, elements in the kernel of (when is not an indicial root) will be bounded polyhomogeneous of order , where is the smallest indicial root bigger than ; in particular, they will be in if .
3.6. Hybrid spaces
Let us now return to the study of the linearised operator from Subsection 3.1.
Firstly, in order to view our base manifold, the Euclidean space , as a compact manifold in the sense needed for the b and scattering calculuses, we consider the radial compactification. If are coordinates on , this consists in considering
and then projecting through the origin onto the open hemisphere
of the unit sphere. The resulting map is
which is a diffeomorphism. The radial compactification of is then simply the closed hemisphere . On it, consider the function
If we apply a cutoff near so that it is smooth and positive, this becomes a boundary defining function. Pulling this back, near infinity we get
We will use this as our boundary defining function on . The boundary of this compactification is a -sphere, which we will refer to as the sphere at infinity.
A crucial observation is that the Euclidean metric on is precisely a scattering metric on the radial compactification, since, away from the origin, it can be written as
where is the metric on the unit -sphere.
Let us now recall the form of our linearised operator for the model monopole on each root subbundle, given by (3.1.2).
On root subbundles for which it has precisely the form required to apply the Fredholm theory for scattering operators, but on the root subbundles for which the action of the Higgs field degenerates. However, in the latter case, let us consider the operator , which near infinity is simply
Since the Dirac operator can be written in terms of scattering derivatives (with no algebraic term), the operator is a b operator. Furthermore, the action of the Higgs field is bounded, so is also a b operator.
This means that we have to treat root subbundles differently depending on whether is or not. Hence, let us define, near infinity, the subbundles
(3.6.1a) | ||||
(3.6.1b) |
of the bundle (where refers to the centraliser of in ). The first one is the subbundle on which the adjoint action of is , and the second one is its orthogonal complement.
Then, the operator near infinity will look like a weighted b operator along the first subbundle and like a scattering operator along the second one.
With that in mind, we make the following definition, where we are further allowing the construction to depend on a parameter which will add regularity (in the form of b derivatives) to the configurations we consider.
Definition \themydefinitioncnt.
We define
where is the orthogonal projection onto , is a smooth cutoff function which is on the unit ball and outside a larger ball, and denotes the corresponding Sobolev space of compactly supported functions.
When the bundle is just an exterior bundle , we will simply write the subscript , and when the bundle is , we will omit the subscript altogether. That is,
(3.6.2) | ||||
(3.6.3) |
Furthermore, we will centre our attention on these spaces for very specific parameters. In particular, we define
following the same notation for subscripts:
(3.6.4) | |||||
(3.6.5) |
Note the difference between and : the subbundle corresponding to the centraliser of loses one b derivative and its weight increases by , whereas the subbundle corresponding to the orthogonal complement loses one scattering derivative while its weight remains the same. This is exactly how we expect our linearised operator to act on each of these subbundles.
Another good indication that these spaces are well suited to our situation is the following result.
Lemma \themylemmacnt.
The maps
and
are continuous for .
Proof.
For the operator , we first note that it is a scattering differential operator of order . This means that we have the continuous map
However, is a b operator of order , so the map
is also continuous. We apply these two facts to the subbundles and , respectively.
For the operator , we use Subsection 2.2. On , the mass term is a constant along the decomposition, so multiplying by it preserves the Sobolev space we find ourselves in. The charge term is a constant weighted by , which also preserves the space. On , however, the mass term vanishes, so we can increase the weight by . In both cases, we can then remove one derivative from the respective Sobolev spaces to obtain maps like the above.
In both cases we are relying on the fact that the connection and Higgs field are smooth near the origin, and hence they locally act between the appropriate spaces. ∎
The specific weights chosen will be important later on for several reasons. Firstly, the index of the operator will depend on the choice of weights. Secondly, we need to make sure that products of elements in these spaces preserve the appropriate properties. The most important of these, which will be used throughout, are in the following lemma.
Lemma \themylemmacnt.
The maps
(3.6.6) | ||||||||
(3.6.7) | ||||||||
(3.6.8) | ||||||||
(3.6.9) |
and
(3.6.10) |
given by the adjoint action on are continuous.
Furthermore, in the first three cases, if we fix an element of the second space, the map is compact from the first space to the codomain.
Proof.
These follow from the properties laid out in Subsection 3.3 combined with Hölder’s inequality.
Let us illustrate this by summarising the proof for the first of the multiplication maps when we take instead of , that is,
We note that
Furthermore, the asymptotic conditions are stronger on the subbundle than on the subbundle (and the regularity conditions are the same). Therefore, it will suffice to prove the multiplication properties for the pointwise multiplication maps
(3.6.11a) | ||||||||
(3.6.11b) | ||||||||
(3.6.11c) |
since these are the spaces that determine the asymptotic conditions along the relevant subbundle combinations.
Let us, once again, restrict our attention to a single case, and provide a proof only for the first of these three maps. We first see that if and are smooth and compactly supported, then
where the relation denotes that there is an inequality if we multiply the right-hand side by a positive constant which does not depend on or . Note that we need to use instead of to account for the b derivatives, since the Euclidean metric is a scattering metric. Now, from Subsection 3.3 and Hölder’s inequality we deduce that
where denotes a compact embedding, and that
This implies the continuity and compactness properties of the multiplication map.
The rest of the proof can be completed using similar methods. ∎
Naturally, the spaces can be substituted by in the above lemma when appropriate.
Lastly, we will also consider spaces of bounded polyhomogeneous sections with different orders on different subbundles. The only relevant one for us is
which will denote bounded polyhomogeneous sections of which are of orders and in the subbundles corresponding to and , respectively. Multiplication properties for such spaces are more straightforward.
3.7. Moduli space setup
Of particular interest are the spaces
(3.7.1) | ||||
(3.7.2) | ||||
(3.7.3) |
which will be used to define the setup of the moduli space of framed monopoles for our mass and charge suggested in Subsection 2.3, now made explicit in the following definition and proposition.
Definition \themydefinitioncnt.
The configuration space of framed monopoles of mass and charge is defined as
The the group of small gauge transformations for this mass and charge is defined as the connected group of gauge transformations whose Lie algebra is
The Bogomolny map restricted to the configuration space is denoted as
Hence, the moduli space of framed monopoles of mass and charge is defined as
We can see that these definitions provide an adequate setup by applying the properties of the hybrid Sobolev spaces involved.
Proposition \themypropositioncnt.
The gauge group is a well-defined Lie group which acts smoothly on the configuration space , and the Bogomolny map is smooth as a map
Furthermore, if , then the maps
and
are continuous for , and so is the linearised operator as a map
Proof.
To define the Lie group we need to consider the Lie group as a compact group of matrices. Then, gauge transformations can be viewed as sections of the vector bundle associated to the space of matrices, subject to a fibrewise condition. If we decompose the space of matrices in a way analogous to , the continuity of (3.6.9) (or, rather, its analogue for this space of matrices) will yield the Lie group structure.
The rest of the properties are a straightforward application of Subsection 3.6 and the continuity of the maps (3.6.6) to (3.6.8). ∎
Another important feature of this setup is that we can perform integration by parts between and .
Lemma \themylemmacnt.
The pairings on the pairs of spaces and are continuous. Hence, we can perform integration by parts between elements of and with any connection in (the first factor of) the configuration space .
Proof.
The continuity of the pairings can be easily seen because is inside .
These pairings imply that we can perform integration by parts, since the functional
is continuous for and zero for smooth, compactly supported elements. ∎
Once again, the spaces can be substituted by in this lemma when appropriate.
4. The linearised problem
With the analytical setup of the previous section, we now aim to study the linearised operator in more detail. In particular, we want to prove that it is Fredholm and surjective. This will rely on the results in Kottke’s work [Kot15], which studies operators on hybrid Sobolev spaces.
4.1. Fredholmness and index
As we saw, along the subbundles and of the adjoint bundle given by (3.6.1), the linearised operator resembles b and scattering Fredholm operators, respectively. As it turns out, we will be able to put both approaches together to prove that the entire operator is Fredholm.
For the computation of the index it will, in fact, be useful to look at a family of related operators. This family will connect our operator with another one which is self-adjoint in the relevant sense, for which the computation of the index is simplified. The family of operators will be defined by modifying the Higgs field.
Let . Recalling (2.2.4a), we have
where the constant sections can be smoothed out near the origin. Then, for a given parameter , we define
Now, by looking at the resulting family of operators , for , we will be able to compute the index. For this is the linearised operator we are interested in, whereas for the b part of the operator will be self-adjoint, which will help in the computation. By keeping the mass term for every we guarantee that the scattering part of the operator remains non-degenerate.
In order to apply Kottke’s Fredholmness and index results, let us establish some relevant notation. We write
(4.1.1a) | ||||
(4.1.1b) |
so that . This acts on sections of , which, near infinity, decomposes as
(4.1.2) |
With respect to this splitting, we write
and we also write . Then, represents the b part of the operator, and hence we can define , whereas represents the scattering part, and hence we can define the operator associated to it. Note that we need to multiply by in order to to make it a b operator. The extra conjugation by will simplify some notation by shifting the b spectrum of the operator.
If, furthermore, the configuration pair is bounded polyhomogeneous (by which we mean that is), then the operator satisfies the necessary properties to apply Kottke’s results. This is summarised in the following lemma, which essentially implies we can compute the index by computing the indices of the scattering and b parts and adding them. The latter contribution will be referred to as the defect.
Lemma \themylemmacnt.
Let the pair be bounded polyhomogeneous, let , and let be as above. Then, we have that:
-
•
is a Dirac operator with respect to the Euclidean metric on , plus an algebraic term of order x.
-
•
Near infinity, commutes with the Clifford action, is skew-Hermitian and has constant rank, and the first term of the splitting (4.1.2) is the kernel of , which also preserves the second term.
-
•
The connection preserves the above splitting, and is of order .
Hence, since is real, if the operator
is Fredholm.
Furthermore, its index is given by
where the defect is locally constant in on and satisfies
when , and
when .
Lastly, elements in the kernel of this operator will be in , where is the smallest indicial root of bigger than .
Proof.
The conditions follow from the definitions, and they imply the conditions (C1–5) in [Kot15, Section 2]. Then, considering that all the elements in the b spectrum are real and of order , we can apply Theorems 2.4 and 3.6 of the same work to obtain the rest of the properties. ∎
This allows us to compute the index of our operator.
Theorem \themytheoremcnt.
Let be bounded polyhomogeneous. Then, the operator
is Fredholm and
(4.1.3) |
Furthermore, elements in its kernel are in .
Proof.
We apply Subsection 4.1. Our aim is to compute the index for and , but we will also have to consider other values of and in order to do so. We set and as above.
It will be useful throughout the proof to consider the positive and negative spinor bundles and over the unit sphere (which satisfy ). We then get Dirac operators
associated to any bundle . We know that, over the sphere, has index . Furthermore, is injective and is surjective when , and vice versa when .
We can extend these bundles and operators radially to , where we also refer to them as and , identifying .
Now, we start by computing the contribution from the b part (the defect) of the operator, so we must find for each . Near infinity, the operator acts on subbundles of the form for (two copies for each such root and copies for , corresponding to ). We have the decomposition
with respect to which we can write
where we combined the form of the Dirac operator over viewed as a cone over the unit sphere with the action of the Higgs field [Nak93]. Note that the radial variable has now been substituted by the inverse of the boundary defining function .
In order to compute the indicial roots, we must consider the operators over the sphere at infinity. For each subbundle , these restrict to
acting on the bundles over the unit sphere
To find their kernels, let us take to be a section of such a bundle. The resulting equations are
(4.1.4a) | ||||
(4.1.4b) |
If we apply to the second equation and substitute using the first, we get
(4.1.5) |
But the eigenvalues of are , for , excluding when [Kuw84, LT06]. Hence, if , we must have
for some integer .
Let us first take , that is, .
When our equations become
(4.1.6a) | ||||
(4.1.6b) |
When , the first equation implies , and the second equation has a space of solutions of dimension . When , (4.1.5) implies , which in turn implies if .
When (which also includes the case where and ), we can perform analogous computations to check that, when , we have a space of solutions of dimension , and, when , we only have the zero solution if .
To summarise the case , when and , we have a space of solutions of dimension , and otherwise we only have the zero solution.
When , we must have , which means that, as we will see, it will not affect our results.
Applying the relationships from Subsection 4.1, we see that
and
when . The last term of the last equation, as we saw, is
Hence,
But since there are no indicial roots in for any , we also have
(4.1.7) |
Figures 4.1.0 and 4.1.0 give a visual representation of the indicial roots for and how we can deduce the defect of the operator.
Now we compute , the contribution to the index from the scattering part, which does not depend on or . This is given by the index of a Dirac operator induced on the sphere at infinity by the operator , which acts on sections of the subbundles , for (two copies for each such root ). But the positive imaginary eigenspaces of are just those for which . Furthermore, for each of these subbundles, the eigenspace of consists of the positive spinor parts. To summarise, we are left with the subbundles
for which .
The Dirac operator restricted to such a bundle at the sphere at infinity is simply , which has index . Putting them all together, we get
(4.1.8) |
Lastly, the order of the bounded polyhomogeneous elements in its kernel follows from the fact that, in the b part, the smallest possible indicial root bigger than for is . ∎
4.2. Surjectivity and kernel
It is also important that the linearised operator be surjective. This relies, among other things, on the flatness of the underlying manifold .
Proposition \themypropositioncnt.
Let be bounded polyhomogeneous, and assume it satisfies the Bogomolny equation. Then, the operator
is surjective. Hence, its kernel is a vector space whose dimension is given by (4.1.3).
Proof.
Consider the formal adjoint of the operator. If we consider the dual spaces and as spaces of distributions (using the pairing), we have the operator
which is the transpose of the operator in the statement. Hence, if we prove that it is injective, we will be done.
Now, suppose that satisfies . Similarly to elements in the kernel of , must must also be bounded polyhomogeneous, which follows from the parametrix construction from Kottke’s work.
To find the order of , we remember that is weighted by , so its dual will be weighted by . In the notation of Subsection 4.1, this corresponds to . Furthermore, the indicial roots of will be the opposite of those of . Using, once again, the same notation, we see that we have no indicial roots in . Therefore, must be bounded polyhomogeneous of order .
Let us consider the operator . Applying the Bogomolny equation and the Weizenböck formula we can see that
where denotes the covariant derivative with respect to the connection [Nak93].
Therefore, and are also bounded polyhomogeneous of orders and , respectively. This means, firstly, that we can integrate by parts to get
Secondly, since , must also be bounded polyhomogeneous of order , which means that we can write
Putting both things together, we get
implying . Given the decay condition on , this implies that , which completes the proof of the surjectivity of the operator. ∎
5. Moduli space construction
We can now use this to construct the moduli space as a smooth manifold. The kernel of the linearised operator will provide the model space for the charts.
To simplify notation, we introduce the following two operators. For a given pair , we write
and
The first operator provides us with the infinitesimal actions of the group of gauge transformations, since . The second operator is the formal adjoint of the first, whose kernel (in the appropriate space) is hence orthogonal to the gauge orbits. It was part of the linearised operator defined in Subsection 3.1, since it provides the Coulomb gauge fixing condition, and will be used in this way again in this section. The notation itself once again draws on the interpretation of configuration pairs as dimensionally reduced connections on , as noted in Subsection 2.1.
5.1. Regularity
Given a monopole in the configuration space, we want to build a chart of the moduli space near this monopole. This will be done by using the implicit function theorem to construct a slice of the gauge action within the subspace of monopoles, which relies on the properties seen in the previous section regarding the linearised operator .
The above properties required some additional assumptions on the regularity of the monopole; however, as it turns out, we can apply a gauge transformation to any monopole to obtain one with this regularity. This is done by choosing a nearby configuration pair with good enough regularity and asymptotic conditions, and then looking for a monopole which is gauge equivalent to ours and also in Coulomb gauge with respect to the chosen configuration pair. This gauge fixing condition together with the Bogomolny equation will then provide an elliptic system, allowing us to obtain the regularity.
This is analogous to the the linearised problem we studied in the previous section. In fact, although the Bogomolny equation is not linear, the gauge fixing condition is, and hence coincides with the one we already used.
Proposition \themypropositioncnt.
Let . Then, if is sufficiently close to , there exists a gauge transformation such that
Furthermore, this gauge transformation is unique within a neighbourhood of the identity.
Proof.
This is a consequence of applying the implicit function theorem to the smooth function
Note that is fixed for the definition of , and that .
Hence, we must prove that the map
is an isomorphism.
Firstly, we note that the operator is Fredholm of index . To see this, we observe that it decomposes near infinity along the subbundles and into an elliptic weighted b operator and a fully elliptic scattering operator. Furthermore, it is formally self-adjoint. To compute the index of the b part we can compute the indicial roots, which must be symmetric with respect to the origin for the appropriate choice of weights. Since there is no indicial root at , which is the relevant weight for our case, the corresponding index must be .
Secondly, we observe that is a compact operator, as a consequence of the compactness properties of the first three multiplication maps in Subsection 3.6, and hence is also Fredholm of index .
Lastly, it is injective, because if is such that , then, using Subsection 3.7,
and hence . This implies that is covariantly constant with respect to the connection part of , which preserves metrics; since must necessarily decay, this means that .
Since the operator is Fredholm of index and injective it must be an isomorphism, as required, completing the proof. ∎
Corollary \themycorollarycnt.
Let . Then, there exists a pair which satisfies that is smooth and compactly supported, and a gauge transformation , such that
Proof.
Firstly, by substituting with its inverse, we can see that the condition is equivalent to
Since the set of pairs satisfying the desired regularity condition is dense in the configuration space, we can always pick such an as close as we want to . Then, we can apply Subsection 5.1 to obtain . ∎
We can now use the gauge fixing condition to obtain the desired regularity for our monopole.
Proposition \themypropositioncnt.
Let be a monopole. Then, there exists a gauge transformation such that
Proof.
Let be a pair obtained from the previous corollary applied to . After applying a gauge transformation to (which we omit for simplicity of notation), we have that
(5.1.1) |
Since is a monopole, we know that . Additionally, since is smooth and compactly supported, so is . Hence, the same can be said of
where . Combining this with the gauge fixing condition (5.1.1), and writing , we have
(5.1.2) |
where is a fibrewise bilinear product between the appropriate spaces and is smooth and compactly supported. Note that this fibrewise product is bounded above and below and uses the Lie bracket to multiply the factors in the adjoint bundle.
The crucial fact to obtain the desired regularity is that
(5.1.3) |
when the weight does not correspond to any indicial root of the operator. We can see that this is essentially an elliptic regularity result adapted to our specific framework. It can be deduced from Kottke’s work and more general analytical results from the b and scattering calculuses. In particular, note that has no off-diagonal terms, simplifying the computations.
We can use this to carry out a bootstrapping argument and obtain the desired regularity. In particular, we prove that, for every ,
where is some fixed irrational number. We can see that, if this is true for every , then must be in , as desired.
Now, the case is simply the condition . The rest will be proven by induction.
The first induction step involves the fact that
which follows from the continuity of the map (3.6.10). Then, from (5.1.2) and (5.1.3) we deduce
The remaining induction steps follow similarly, since the same multiplication property also implies
(see Subsection 3.3), allowing us to apply (5.1.2) and (5.1.3) once more to obtain the needed expression.
∎
5.2. Smoothness
If we hope to model the moduli space near a monopole by looking at a small slice near a representative, we also need to know that sufficiently close orbits will only intersect this slice once. The following lemma and its corollary allow us to do that.
Lemma \themylemmacnt.
Let and be sequences of configuration pairs in , and let be a sequence of gauge transformations in such that for all . If the sequences of configuration pairs have limits and , respectively, in , then the sequence of gauge transformations will have a limit in such that .
Proof.
Once again, we consider gauge transformations as sections of a vector bundle.
Let and for all (including ). Then, the condition is equivalent to
(5.2.1) |
The proof then proceeds similarly to that of Lemma 4.2.4 in Donaldson’s and Kronheimer’s book [DK90], although we must modify the first few steps to ensure we have the appropriate asymptotic conditions.
At each step, we start by knowing that and are uniformly bounded in the norm of , and that is uniformly bounded in some other norm (initially, the norm). We then use (5.2.1) to obtain a uniform bound on a better norm for . We will firstly obtain bounds on weighted , norms, and afterwards on a Sobolev norm.
This implies that there will be a weak limit , which must satisfy the equation
(5.2.2) |
We can then prove that is in and is in fact the strong limit of the sequence through a bootstrapping argument using (5.2.1) and (5.2.2): we start in the same way as before, and then continue until we obtain the appropriate bounds on the norm of . Note that to start the bootstrapping argument for the strong convergence we rely on the fact that . ∎
Corollary \themycorollarycnt.
In Subsection 5.1, if is assumed to be sufficiently close to , the gauge transformation must be unique in the entire group .
Proof.
Let us suppose, on the contrary, that we have a sequence of configuration pairs in and a sequence of gauge transformations in such that the sequences and tend to and are in Coulomb gauge with respect to it. By Subsection 5.1, the sequence must eventually be bounded away from the identity (where we once again consider gauge transformations as sections of a vector bundle). Then, we can deduce from Subsection 5.2 that there exists a such that . This is not possible given the asymptotic conditions on . ∎
We now have all the necessary elements to prove that our moduli space, constructed as a quotient, is smooth.
Proposition \themypropositioncnt.
The quotient is smooth.
Proof.
Firstly, we observe that is a submanifold of , since the Bogomolny map is a submersion. Hence, we want to give the quotient by a smooth structure such that the projection map from is a smooth submersion. Note that such a smooth structure must be unique.
We firstly observe that Subsection 5.2 implies that the quotient is Hausdorff. Indeed, if and are points in the quotient, and they don’t have disjoint open neighbourhoods, we can construct a sequence of points in the quotient which gets arbitrary close to both points. This means that, in the configuration space, these can be lifted to two sequences, and which tend to and , respectively, and are pairwise gauge equivalent. But then the limits must also be gauge equivalent.
Now let us take a point in this quotient, represented by a monopole . By Subsection 5.1, we may assume that it is bounded polyhomogeneous. Consider the function
Its derivative is precisely the operator that we studied in the previous section, which is Fredholm and surjective, so applying the implicit function theorem allows us to identify a small ball in its kernel (which is a finite dimensional vector space of known dimension) with the set of monopoles near which are in Coulomb gauge with respect to it. But, by Subsection 5.2, all monopoles in an orbit close enough to the orbit of must have a unique such representative, so this gives us a chart.
The smoothness of the transition functions follows from the uniqueness of the quotient smooth structure. ∎
Note that our definition of moduli space was, a priori, dependent on a regularity parameter . However, we can see that for any two choices of this parameter, the resulting quotients are naturally diffeomorphic.
Proposition \themypropositioncnt.
The smooth structure on the moduli space does not depend on the choice of .
Proof.
Given that every monopole is gauge equivalent to a bounded polyhomogeneous one, the sets of monopoles are the same independently of . Furthermore, if two monopoles are related by a gauge transformation , for , then we must have . This follows from the same bootstrapping argument as in the proof of Subsection 5.2. Therefore, the underlying set of the moduli space is independent of . Furthermore, the slice constructed in Subsection 5.2 must be the same independently of , so the smooth structure is also the same. ∎
5.3. The hyper-Kähler metric
One of the benefits of constructing the moduli space of framed monopoles is that we expect it to inherit a hyper-Kähler metric from the inner product in the configuration space. This is because the moduli space construction can be viewed as an infinite-dimensional hyper-Kähler reduction. Throughout this subsection we can once again notice the analogy with connections on mentioned in Subsection 2.1.
To set up the hyper-Kähler reduction, we start by identifying the base manifold with the imaginary quaternions. This provides a quaternionic structure on the bundle (which can be identified with ), compatible with the Euclidean metric. This, in turn, provides a quaternionic structure on the space , since it is a space of sections of . Furthermore, the inner product, which is bounded by Subsection 3.7, is compatible with it. This gives the configuration space the structure of a flat, infinite-dimensional hyper-Kähler manifold. Combining the analogous expressions for the quaternions with the inner product we can write out this structure in the following terms.
Proposition \themypropositioncnt.
The configuration space is a hyper-Kähler manifold with respect to the metric. If and , then
defines the triple of symplectic forms.
In the above expression, the fibrewise inner product is given by the metric on the adjoint bundle, and combines this inner product with the wedge product of -forms. The integrand is then a -form over . But, as stated above, this is the same as an -valued function, which can be integrated with respect to the Euclidean measure to give an element of .
It is easy to check that the gauge transformations respect this hyper-Kähler structure, but, as it turns out, the properties of the gauge action go far beyond this.
Proposition \themypropositioncnt.
The group of gauge transformations acts on the configuration space through a tri-Hamiltonian action, and the moment map is given by the Bogomolny map .
Proof.
Consider the pairing
given by the inner product using the metric on the adjoint bundle, which is continuous by Subsection 3.7. Since the second space contains sections of the bundle rather than just , the pairing is valued in , using the same identification as above. This means that we can write
where denotes the space of continuous linear functionals on . Note that the Bogomolny map takes values precisely in this space, as we would expect of a moment map.
Now, the condition for the action to be tri-Hamiltonian is
for all , and . Combining the expression for the symplectic form from Subsection 5.3 with the ones for the derivative of the Bogomolny map and the infinitesimal actions from Subsection 2.1, we see that this condition is equivalent to
for all , and . The middle summands are the same on both sides given the skew-symmetry of the adjoint action. By Subsection 3.7, we can apply integration by parts to identify the first and third summands. ∎
Putting this together with the smoothness of the moduli space we complete the construction.
Proposition \themypropositioncnt.
The metric on descends to a hyper-Kähler metric on the moduli space .
Proof.
Subsection 5.3 implies that our moduli space construction is “formally” a hyper-Kähler reduction, since we have
Hence, given that this space is smooth, the quotient metric must be hyper-Kähler. Note that at each monopole the metric is given by the norm on the kernel of , which is the tangent space to the moduli space and independent of (when a suitable representative is chosen). ∎
5.4. The moduli space
To simplify the dimension formula let us define as a set of positive roots such that
where the only ambiguity arises from roots such that .
Then, putting the previous results together we obtain the following.
Theorem \themytheoremcnt.
For any mass and charge , the moduli space of framed monopoles is either empty or a smooth hyper-Kähler manifold of dimension
Although there are differing conventions surrounding Lie algebras, we can check that the dimension of these moduli spaces coincides with the dimension formula given by Murray and Singer from the corresponding spaces of rational maps [MS03]. Indeed, let us consider the fundamental weights associated the choice of positive roots. If are the simple roots of , we get corresponding fundamental weights . In terms of these weights, our dimension formula becomes
which coincides with Murray’s and Singer’s. The numbers are the charges, which are called magnetic when and holomorphic otherwise.
In the case of , of course, the only resulting integer from the above procedure is the usual charge, and our dimension computation yields four times this value, as expected.
For other groups, since our moduli spaces depend on fixing all the charges, in the case of non-maximal symmetry breaking they will correspond to the fibres of the strata in the stratified moduli space of monopoles sharing only the magnetic charges, as noted in Subsection 1.1.
Let us illustrate this with the case of with non-maximal symmetry breaking, corresponding to
Here, the symmetry breaks to the non-Abelian group
which is isomorphic to .
The case in which the (only) magnetic charge is set to has been studied in some detail [Dan92, Dan93, BS98]. In it, the (only) holomorphic charge can be or , corresponding to
respectively. For the former choice, our construction yields a moduli space of dimension , whereas for the latter it produces a moduli space of dimension .
In the stratified moduli space picture, the -dimensional space forms the open stratum, whereas the -dimensional space provides the fibres of the lower -dimensional stratum. Notice that the stabiliser of the mass also preserves the first choice of charge; in the second case, however, the stabiliser of the charge is the smaller group
which is isomorphic to . This accounts for the -dimensional base of the fibration,
As it turns out, the monopoles in this case are essentially -monopoles embedded into the bundle, where the base of the fibration represents the possible embeddings (and hence framings).
Acknowledgements
This work is based on research carried out in the course of my PhD studies, and hence I want to acknowledge first of all the help and support of my PhD supervisor, Michael Singer, as well as of my second supervisor, Andrew Dancer, who have provided ideas, support, suggestions, corrections, and much more. I have also benefited from very useful conversations with other researchers, including Chris Kottke, Jason Lotay, Calum Ross and many (other) members of staff and students at the LSGNT and UCL. This work was supported by the Engineering and Physical Sciences Research Council [EP/L015234/1] – the EPSRC Centre for Doctoral Training in Geometry and Number Theory at the Interface (the London School of Geometry and Number Theory), University College London.
References
- [AH88] Michael F. Atiyah and Nigel J. Hitchin “The Geometry and Dynamics of Magnetic Monopoles”, M. B. Porter Lectures Princeton University Press, 1988
- [BS98] F.. Bais and Bernd J. Schroers “Quantisation of Monopoles with Non-Abelian Magnetic Charge” In Nuclear Physics B 512.1–2, 1998, pp. 250–294
- [Bie98] Roger Bielawski “Asymptotic Metrics for -Monopoles with Maximal Symmetry Breaking” In Communications in Mathematical Physics 199.2, 1998, pp. 297–325
- [Cal78] Constantine Callias “Axial Anomalies and Index Theorems on Open Spaces” In Communications in Mathematical Physics 62.3, 1978, pp. 213–234
- [Can75] M. Cantor “Spaces of Functions with Asymptotic Conditions on ” In Indiana University Mathematics Journal 24.9, 1975, pp. 897–902
- [CN22] Benoit Charbonneau and Ákos Nagy “On the Construction of Monopoles with Arbitrary Symmetry Breaking”, 2022 arXiv:2205.15246 [math.DG]
- [Dan92] Andrew S. Dancer “Nahm Data and Monopoles” In Nonlinearity 5.6, 1992, pp. 1355–1373
- [Dan93] Andrew S. Dancer “Nahm’s Equations and Hyperkähler Geometry” In Communications in Mathematical Physics 158.3, 1993, pp. 545–568
- [DK90] Simon K. Donaldson and Peter B. Kronheimer “The Geometry of Four-Manifolds”, Oxford Mathematical Monographs Oxford Science Publications, 1990
- [Hur89] Jacques Hurtubise “The Classification of Monopoles for the Classical Groups” In Communications in Mathematical Physics 120.4, 1989, pp. 613–641
- [HM89] Jacques Hurtubise and Michael K. Murray “On the Construction of Monopoles for the Classical Groups” In Communications in Mathematical Physics 122.1, 1989, pp. 35–89
- [JT80] Arthur M. Jaffe and Clifford H. Taubes “Vortices and Monopoles”, Progress in Physics 2 Birkhäuser, 1980
- [Jar98] Stuart Jarvis “Euclidean Monopoles and Rational Maps” In Proceedings of the London Mathematical Society 77.1, 1998, pp. 170–192
- [Jar98a] Stuart Jarvis “Construction of Euclidean Monopoles” In Proceedings of the London Mathematical Society 77.1, 1998, pp. 193–214
- [Jar00] Stuart Jarvis “A Rational Map of Euclidean Monopoles via Radial Scattering” In Journal für die Reine und Angewandte Mathematik 2000.524, 2000, pp. 17–44
- [Kot11] Chris Kottke “An Index Theorem of Callias Type for Pseudodifferential Operators” In Journal of -Theory 8.3, 2011, pp. 387–417
- [Kot15] Chris Kottke “A Callias-Type Index Theorem with Degenerate Potentials” In Communications in Partial Differential Equations 40.2, 2015, pp. 219–264
- [Kot15a] Chris Kottke “Dimension of Monopoles on Asymptotically Conic -Manifolds” In Bulletin of the London Mathematical Society 47.5, 2015, pp. 818–834
- [Kuw84] Ruishi Kuwabara “Some Spectral Results for the Laplacian on Line Bundles over ” In Commentarii Mathematici Helvetici 59.5, 1984, pp. 439–458
- [LM85] Robert B. Lockhart and Robert C. McOwen “Elliptic Differential Operators on Noncompact Manifolds” In Annali della Scuola Normale Superiore di Pisa - Classe di Scienze 12.3, 4, 1985, pp. 409–447
- [LT06] Antonio López Almorox and Carlos Tejero Prieto “Holomorphic Spectrum of Twisted Dirac Operators on Compact Riemann Surfaces” In Journal of Geometry and Physics 56.10, 2006, pp. 2069–2091
- [Mel93] Richard B. Melrose “The Atiyah–Patodi–Singer Index Theorem” A K Peters, 1993
- [Mel94] Rochard B. Melrose “Spectral and Scattering Theory for the Laplacian on Asymptotically Euclidean Spaces” In Spectral and Scattering Theory 161, Lecture Notes in Pure and Applied Mathematics CRC Press, 1994
- [Mur89] Michael K. Murray “Stratifying Monopoles and Rational Maps” In Communications in Mathematical Physics 125.4, 1989, pp. 661–674
- [MS03] Michael K. Murray and Michael A. Singer “A Note on Monopole Moduli Spaces” In Journal of Mathematical Physics 44.8, 2003, pp. 3517–3531
- [Nak93] Hiraku Nakajima “Monopoles and Nahm’s Equations” In Einstein Metrics and Yang–Mills Connections 145, Lecture Notes in Pure and Applied Mathematics CRC Press, 1993
- [Sán19] Raúl Sánchez Galán “Monopoles in ”, 2019