Tipping Cycles

Michael A.S. Thorne
British Antarctic Survey

Ecological systems are studied using many different approaches and mathematical tools. One approach, based on the Jacobian of Lotka-
Volterra type models, has been a staple of mathematical ecology for years, leading to many ideas such as on questions of system stability. Instability in such methods is determined by the presence of an eigenvalue of the community matrix lying in the right half plane. The coefficients of the characteristic polynomial derived from community matrices contain information related to the specific matrix elements that play a greater destabilising role. Yet the destabilising circuits, or cycles, constructed by multiplying these elements together, form only a subset of all the feedback loops comprising a given system. This paper looks at the destabilising feedback loops in predator-prey, mutualistic and competitive systems in terms of sets of the matrix elements to explore how sign structure affects how the elements contribute to instability. This leads to quite rich combinatorial structure among the destabilising cycle sets as set size grows within the coefficients of the characteristic polynomial.

Within mathematical ecology, one approach [2] to represent predator-prey, mutualistic and competitive systems is through the community matrix, a real-valued square matrix representing the linearisation of Lotka-Volterra type dynamic equations ([4],[8]). Each of the forms is represented through differing sign conventions as can be seen in the following 3×3333\times 3 examples:

Predator-Prey Mutualistic Competitive
[abcdefghk]matrix𝑎𝑏𝑐𝑑𝑒𝑓𝑔𝑘\begin{bmatrix}-a&b&c\\ -d&-e&f\\ -g&-h&-k\end{bmatrix} [abcdefghk]matrix𝑎𝑏𝑐𝑑𝑒𝑓𝑔𝑘\begin{bmatrix}-a&b&c\\ d&-e&f\\ g&h&-k\end{bmatrix} [abcdefghk]matrix𝑎𝑏𝑐𝑑𝑒𝑓𝑔𝑘\begin{bmatrix}-a&-b&-c\\ -d&-e&-f\\ -g&-h&-k\end{bmatrix}.

Stability of a community matrix is determined by whether all of the eigenvalues lie in the left half of the complex plane. The characteristic polynomial of an n×n𝑛𝑛n\times n community matrix is an nthsuperscript𝑛𝑡n^{th}-order monic polynomial (or made so by change of sign), whose roots are the eigenvalues of the system. A necessary condition for the roots of a polynomial to all lie in the left half plane, and therefore for the system to be stable, is for all of its coefficients to be positive. However, this condition is not sufficient. The Routh-Hurwitz stability criteria ([3],[6]) provides a further, and sufficient, condition. The following equation is an example of a polynomial satisfying the necessary condition of positive coefficients,

(1) x4+2x3+3x2+4x+5=0,superscript𝑥42superscript𝑥33superscript𝑥24𝑥50x^{4}+2x^{3}+3x^{2}+4x+5=0,

yet whose Routh table (Table 1) reflects the existence of two roots in the right half plane and is therefore not Routh-Hurwitz stable.

x4superscript𝑥4x^{4} 1 3 5
x3superscript𝑥3x^{3} 2 4
x2superscript𝑥2x^{2} 1 5
x1superscript𝑥1x^{1} -6
x0superscript𝑥0x^{0} 5
Table 1: Table 1 The Routh table for Eq. 1. The number of sign changes as one moves down the first column indicate the number of roots in the right half plane. In this case, two.

Polynomials of the example just described can only have roots in the right half plane that are complex conjugate pairs. This was proven by Obrechkoff [5], who showed that there are no solutions to polynomials with positive coefficients that lie on the positive real axis (the right half plane roots of Eq. 1 are 0.29±1.42iplus-or-minus0.291.42𝑖0.29\pm 1.42i).

Therefore, any systems that have a real maximal (largest real part) eigenvalue (with imaginary part zero) have their tipping point between stability and instability just where the last coefficient of their characteristic polynomial becomes positive. This point is helpful in considering what contributes to the destabilisation of a system through untangling the elements that make up the feedbacks.

The idea of a tipping point is not very informative without its context, without knowledge of the feedbacks that produce the instability. Ecological systems that are modelled by community matrices have the benefit of the direct relation through the coefficients of the characteristic polynomial which are derived from the minors, or respectively the summations of the n-tuple sets of the eigenvalues [1], of the matrix. These minors may be exhaustively described by the terms consisting of sets of multiplied elements of the community matrix. These terms are the feedback loops of the system, otherwise called circuits, or cycles. Within each coefficient of a characteristic polynomial, one can distinguish the cycles that contribute to the coefficient becoming more positive, and therefore stabilising, or more negative and destabilising. For example, consider the general characteristic polynomial of the 3×3333\times 3 predator-prey community matrix described above,

a3x3+a2x2+a1x+a0,subscript𝑎3superscript𝑥3subscript𝑎2superscript𝑥2subscript𝑎1𝑥subscript𝑎0a_{3}x^{3}+a_{2}x^{2}+a_{1}x+a_{0},

which expands, in terms of its matrix elements as,

x3+(a+e+k)x2+(bd+ae+cg+fh+ak+ek)x+(ceg+bfg+afh+bdk+aekcdh).superscript𝑥3𝑎𝑒𝑘superscript𝑥2𝑏𝑑𝑎𝑒𝑐𝑔𝑓𝑎𝑘𝑒𝑘𝑥𝑐𝑒𝑔𝑏𝑓𝑔𝑎𝑓𝑏𝑑𝑘𝑎𝑒𝑘𝑐𝑑x^{3}+(a+e+k)x^{2}+(bd+ae+cg+fh+ak+ek)x+(ceg+bfg+afh+bdk+aek{\color[rgb]{1,0,0}-cdh}).

Given that characteristic polynomials are monic, we know that the highest order coefficient, a3subscript𝑎3a_{3}, is 111 and therefore positive, a2subscript𝑎2a_{2} is the negative of the trace, and therefore positive, and as can be seen, a1subscript𝑎1a_{1}, the summed combination of 2-tuples, is also positive. This leaves only a0subscript𝑎0a_{0} able to switch between being positive or negative, and therefore able to destabilise the system. For clarity of explanation, we have used the change of sign of the coefficient for consideration of stability, even though this is only a clear indication in systems with a maximal real-valued eigenvalue. But the effect of increasing the positive or negative value of a coefficient on its stability applies to all systems. Within a0subscript𝑎0a_{0}, highlighted above and below in red, the only destabilising circuit, or tipping cycle, is cdh𝑐𝑑cdh,

[abcdefghk].delimited-[]𝑎𝑏𝑐𝑑𝑒𝑓𝑔𝑘\left[\begin{array}[]{rrr}-a&b&{\color[rgb]{1,0,0}c}\\ {\color[rgb]{1,0,0}-d}&-e&f\\ -g&{\color[rgb]{1,0,0}-h}&-k\end{array}\right].

This means that however large the other elements are, they cannot force the system to become unstable (if it is not already so), only the circuit of c, d and h can do that. Given that there are five other cycles of size three that make up the a0subscript𝑎0a_{0} coefficient, it is helpful to consider a ratio, the coefficient feedback sensitivity, ai~~subscript𝑎𝑖\tilde{a_{i}}, which in this case is

a0~=1/6.~subscript𝑎016\tilde{a_{0}}=1/6.

Table 2 shows the values of ai~~subscript𝑎𝑖\tilde{a_{i}} for predator-prey, mutualistic and competitive systems up to 8×8888\times 8 sized community matrices.

n𝑛n a8subscript𝑎8a_{8}x8superscript𝑥8x^{8} a7subscript𝑎7a_{7}x7superscript𝑥7x^{7} a6subscript𝑎6a_{6}x6superscript𝑥6x^{6} a5subscript𝑎5a_{5}x5superscript𝑥5x^{5} a4subscript𝑎4a_{4}x4superscript𝑥4x^{4} a3subscript𝑎3a_{3}x3superscript𝑥3x^{3} a2subscript𝑎2a_{2}x2superscript𝑥2x^{2} a1subscript𝑎1a_{1}x𝑥x a0subscript𝑎0a_{0}
P-P 222 + + +
333 + + + 1/6
444 + + + 4/24 8/24
555 + + + 10/60 40/120 52/120
666 + + + 20/120 120/360 312/720 344/720
777 + + + 35/210 280/840 1092/2520 2408/5040 2488/5040
888 + + + 56/336 560/1680 2912/6720 9632/20160 19904/40320 20096/40320
C 222 + + 1/2
333 + + 3/6 3/6
444 + + 6/12 12/24 12/24
555 + + 10/20 30/60 60/120 60/120
666 + + 15/30 60/120 180/360 360/720 360/720
777 + + 21/42 105/210 420/840 1260/2520 2520/5040 2520/5040
888 + + 28/56 168/336 840/1680 3360/6720 10080/20160 20160/40320 20160/40320
M 222 + + 1/2
333 + + 3/6 5/6
444 + + 6/12 20/24 20/24
555 + + 10/20 50/60 100/120 84/120
666 + + 15/30 100/120 300/360 504/720 424/720
777 + + 21/42 175/210 700/840 1764/2520 2968/5040 2680/5040
888 + + 28/56 280/336 1400/1680 4704/6720 11872/20160 21440/40320 20544/40320
Table 2: Table 2 For the three forms under discussion ai~~subscript𝑎𝑖\tilde{a_{i}} is presented for systems up n=8𝑛8n=8. By the inherent sign symmetries and proportions it would be reasonable to suggest that, for any size n𝑛n, ai~<1/2~subscript𝑎𝑖12\tilde{a_{i}}<1/2 in predator-prey (P-P) systems (but as n𝑛n increases, a0subscript𝑎0a_{0} asymptotically tends to 1/2121/2), ai~1/2~subscript𝑎𝑖12\tilde{a_{i}}\geq 1/2 in mutualistic (M) systems (the case when ai~=1/2~subscript𝑎𝑖12\tilde{a_{i}}=1/2 only when the diagonal terms do not play a role in the cycles contributing to destabilisation), and ai~=1/2~subscript𝑎𝑖12\tilde{a_{i}}=1/2 in competitive (C) systems. Coefficients indicated by a ++ have no negative destabilising cycles and therefore ai~=0~subscript𝑎𝑖0\tilde{a_{i}}=0. The total number of terms (denominator) for each aisubscript𝑎𝑖a_{i} is n!/i!𝑛𝑖n!/i!. The values of the numerators of the highest predator-prey ai~~subscript𝑎𝑖\tilde{a_{i}} follow the tetrahedral numbers, while the mutualistic and competitive highest order numerators of the aisubscript𝑎𝑖a_{i} are the triangular numbers. The sequence of tipping cycles of the competitive systems for a given n𝑛n as i𝑖i decreases follows the sequence of path polynomials of the complete graph Knsubscript𝐾𝑛K_{n} [7].

Consider the 4×4444\times 4 predator-prey community matrix,

[abcdefghklmpqrst],delimited-[]𝑎𝑏𝑐𝑑𝑒𝑓𝑔𝑘𝑙𝑚𝑝𝑞𝑟𝑠𝑡\left[\begin{array}[]{rrrr}-a&b&c&d\\ -e&-f&g&h\\ -k&-l&-m&p\\ -q&-r&-s&-t\end{array}\right],

then the coefficient a1subscript𝑎1a_{1}, consisting of 3-cycles (ni𝑛𝑖n-i) is,

cfk+bgk+agl+bem+afm+dfq+bhq+dmq+cpq+ahr+hmr+gpr+
                              aps+fps+bet+aft+ckt+glt+amt+fmt-cel-der-dks-hls.

We define the tipping cycle set of a1subscript𝑎1a_{1} as a1^={cel,der,dks,hls}^subscript𝑎1𝑐𝑒𝑙𝑑𝑒𝑟𝑑𝑘𝑠𝑙𝑠\hat{a_{1}}=\{cel,der,dks,hls\}. These four negative cycles (a1~=4/24~subscript𝑎1424\tilde{a_{1}}=4/24), that if strong enough, could tip the a1subscript𝑎1a_{1} coefficient from positive to negative, destabilising the system, consist of only eight distinct matrix elements, c,d,e,h,k,l,r𝑐𝑑𝑒𝑘𝑙𝑟c,d,e,h,k,l,r and s𝑠s, with each element included in a differing number of cycles. That is, each element has a specific weight. If we construct a weighted matrix of the elements of this tipping cycle set ([a1^]delimited-[]^subscript𝑎1[\hat{a_{1}}]) one can clearly see the patterning of the key elements that play a role in destabilisation,

[a1^]=[0012200112000120].delimited-[]^subscript𝑎1delimited-[]0012200112000120[\hat{a_{1}}]=\left[\begin{array}[]{rrrr}0&0&1&2\\ 2&0&0&1\\ 1&2&0&0\\ 0&1&2&0\end{array}\right].

Applied to all the different forms, we can see that the sign structure of the matrix has an effect on the different elements in their role in the destabilising cycles,

[a0^]=delimited-[]^subscript𝑎0absent[\hat{a_{0}}]= Predator-Prey Competitive Mutualistic [1133311333111331]matrix1133311333111331\begin{bmatrix}1&1&3&3\\ 3&1&1&3\\ 3&3&1&1\\ 1&3&3&1\end{bmatrix} [3333333333333333]matrix3333333333333333\begin{bmatrix}3&3&3&3\\ 3&3&3&3\\ 3&3&3&3\\ 3&3&3&3\end{bmatrix} [5555555555555555]matrix5555555555555555\begin{bmatrix}5&5&5&5\\ 5&5&5&5\\ 5&5&5&5\\ 5&5&5&5\end{bmatrix}

[a1^]=delimited-[]^subscript𝑎1absent[\hat{a_{1}}]= [0012200112000120]matrix0012200112000120\begin{bmatrix}0&0&1&2\\ 2&0&0&1\\ 1&2&0&0\\ 0&1&2&0\end{bmatrix} [3222232222322223]matrix3222232222322223\begin{bmatrix}3&2&2&2\\ 2&3&2&2\\ 2&2&3&2\\ 2&2&2&3\end{bmatrix} [3444434444344443]matrix3444434444344443\begin{bmatrix}3&4&4&4\\ 4&3&4&4\\ 4&4&3&4\\ 4&4&4&3\end{bmatrix}

[a2^]=delimited-[]^subscript𝑎2absent[\hat{a_{2}}]= [0000000000000000]matrix0000000000000000\begin{bmatrix}0&0&0&0\\ 0&0&0&0\\ 0&0&0&0\\ 0&0&0&0\end{bmatrix} [0111101111011110]matrix0111101111011110\begin{bmatrix}0&1&1&1\\ 1&0&1&1\\ 1&1&0&1\\ 1&1&1&0\end{bmatrix} [0111101111011110]matrix0111101111011110\begin{bmatrix}0&1&1&1\\ 1&0&1&1\\ 1&1&0&1\\ 1&1&1&0\end{bmatrix}

In addition, the total weighting of the elements in their role in destabilisation across all the coefficients are a summation of the individual coefficient tipping cycle set weightings,

[1145511445111451][6666666666666666][8101010108101010108101010108].superscriptsubscript𝑖0𝑛delimited-[]^subscript𝑎𝑖fragments matrix1145511445111451matrix6666666666666666fragmentsmatrix8101010108101010108101010108.\sum_{i=0}^{n}[\hat{a_{i}}]=\begin{tabular}[]{l c c c}&Predator-Prey&Competitive&Mutualistic\\ &$\begin{bmatrix}1&1&4&5\\ 5&1&1&4\\ 4&5&1&1\\ 1&4&5&1\end{bmatrix}$&$\begin{bmatrix}6&6&6&6\\ 6&6&6&6\\ 6&6&6&6\\ 6&6&6&6\end{bmatrix}$&$\begin{bmatrix}8&10&10&10\\ 10&8&10&10\\ 10&10&8&10\\ 10&10&10&8\end{bmatrix}.$ \par\vskip 6.0pt plus 2.0pt minus 2.0pt\\ \end{tabular}
i=0n[ai^]= Predator-PreyCompetitiveMutualisticPredator-PreyCompetitiveMutualistic

Extending the summed weightings to the 5×5555\times 5 systems,

Predator-Prey Competitive Mutualistic
[12112023242412112023232412112020232412111120232412]matrix12112023242412112023232412112020232412111120232412\begin{bmatrix}12&11&20&23&24\\ 24&12&11&20&23\\ 23&24&12&11&20\\ 20&23&24&12&11\\ 11&20&23&24&12\end{bmatrix} [30252525252530252525252530252525252530252525252530]matrix30252525252530252525252530252525252530252525252530\begin{bmatrix}30&25&25&25&25\\ 25&30&25&25&25\\ 25&25&30&25&25\\ 25&25&25&30&25\\ 25&25&25&25&30\end{bmatrix} [46383838383846383838383846383838383846383838383846].matrix46383838383846383838383846383838383846383838383846\begin{bmatrix}46&38&38&38&38\\ 38&46&38&38&38\\ 38&38&46&38&38\\ 38&38&38&46&38\\ 38&38&38&38&46\end{bmatrix}.

The symmetry seen in the competitive and mutualistic i=0n[ai^]superscriptsubscript𝑖0𝑛delimited-[]^subscript𝑎𝑖\sum_{i=0}^{n}[\hat{a_{i}}] are clearly a consequence of the symmetry in the sign structure of these two forms, while for the predator-prey systems it reflects its lack of sign symmetry. Such bias in the weighting of certain individual elements in the predator-prey case raises the question as to how much stability or instability is an artifact of the structure. For example, in larger systems, positioning of one species over another in the governing equations from which the community matrices are constructed may prove crucial for the outcome. That is, it posits the question of whether the medium may well be the message.

If the elements comprising tipping cycles are considered in terms of set inclusion, in which for a given ai^^subscript𝑎𝑖\hat{a_{i}} set comparability is considered as an antichain, and the set inclusion properties of smaller to larger sized cycles is likewise determined by the collection of elements, then we can describe the inclusion properties of ai^^subscript𝑎𝑖\hat{a_{i}} as i𝑖i decreases for a given n𝑛n. To see this, we again look at the 4×4444\times 4 predator-prey system, where the 4-cycles are a0^={chlq,dgkr,demr,cepr,dfks,bhks,ahls,celt}^subscript𝑎0𝑐𝑙𝑞𝑑𝑔𝑘𝑟𝑑𝑒𝑚𝑟𝑐𝑒𝑝𝑟𝑑𝑓𝑘𝑠𝑏𝑘𝑠𝑎𝑙𝑠𝑐𝑒𝑙𝑡\hat{a_{0}}=\{chlq,dgkr,demr,cepr,dfks,bhks,ahls,celt\}. In terms of the constituent elements, the set of 3-cycles of a1^^subscript𝑎1\hat{a_{1}} are subsets of some of the 4-cycles of a0^^subscript𝑎0\hat{a_{0}} (i.e. cel \in celt):

a1^a0^.^subscript𝑎1^subscript𝑎0\hat{a_{1}}\subset\hat{a_{0}}.

This property, in which the smaller tipping cycle sets are a subset of the larger sized sets holds across all the forms of matrices for a given n𝑛n:

ai^a^j,j<i.^subscript𝑎𝑖subscript^𝑎𝑗for-all𝑗𝑖\hat{a_{i}}\subset\hat{a}_{j,\ \forall j<i}.

Yet the way the different forms (i.e. predator-prey, mutualistic and competitive) result in different element weightings is also reflected in the different ways their ai^^subscript𝑎𝑖\hat{a_{i}} flow through their aisubscript𝑎𝑖a_{i} as i𝑖i decreases.

For example, with the 4×4444\times 4 predator-prey system, there are four tipping cycles in a1^^subscript𝑎1\hat{a_{1}} and eight tipping cycles in a0^^subscript𝑎0\hat{a_{0}}. While the four smaller sets of a1^^subscript𝑎1\hat{a_{1}} are subsets of sets in a0^^subscript𝑎0\hat{a_{0}}, the four remaining sets of a0^^subscript𝑎0\hat{a_{0}} do not have such an embedding from sets of a1^^subscript𝑎1\hat{a_{1}}, but are new configurations of elements from the 4×4444\times 4 system (i.e. {cel,der,dks,hls}{celt,demr,dfks,ahls}+{chlq,dgkr,cepr,bhks}𝑐𝑒𝑙𝑑𝑒𝑟𝑑𝑘𝑠𝑙𝑠𝑐𝑒𝑙𝑡𝑑𝑒𝑚𝑟𝑑𝑓𝑘𝑠𝑎𝑙𝑠𝑐𝑙𝑞𝑑𝑔𝑘𝑟𝑐𝑒𝑝𝑟𝑏𝑘𝑠\{cel,der,dks,hls\}\subset\{celt,demr,dfks,ahls\}+\{chlq,dgkr,cepr,bhks\}).

In the 4×4444\times 4 competitive case, the six sets in a2^^subscript𝑎2\hat{a_{2}} are subsets in two sets each in a1^^subscript𝑎1\hat{a_{1}}, but in this case there are no new configurations. Six of the twelve sets of a0^^subscript𝑎0\hat{a_{0}} consist of two sets each from a1^^subscript𝑎1\hat{a_{1}} (these are sets constructed through the possible combination of having two of the four diagonal elements, (42)binomial42\binom{4}{2}), with six new configurations:

a2^^subscript𝑎2\hat{a_{2}} a1^^subscript𝑎1\hat{a_{1}} a0^^subscript𝑎0\hat{a_{0}}
{beckgldqhrps}𝑏𝑒𝑐𝑘𝑔𝑙𝑑𝑞𝑟𝑝𝑠absent\left\{\begin{array}[]{c}be\\ ck\\ gl\\ dq\\ hr\\ ps\end{array}\right\}\subset {bembetcfkcktaglgltdfqdmqahrhmrapsfps}𝑏𝑒𝑚𝑏𝑒𝑡𝑐𝑓𝑘𝑐𝑘𝑡𝑎𝑔𝑙𝑔𝑙𝑡𝑑𝑓𝑞𝑑𝑚𝑞𝑎𝑟𝑚𝑟𝑎𝑝𝑠𝑓𝑝𝑠absent\left\{\begin{array}[]{c}bem\\ bet\\ cfk\\ ckt\\ agl\\ glt\\ dfq\\ dmq\\ ahr\\ hmr\\ aps\\ fps\\ \end{array}\right\}\subset {bemtcfktagltdfmqahmrafps}+limit-from𝑏𝑒𝑚𝑡𝑐𝑓𝑘𝑡𝑎𝑔𝑙𝑡𝑑𝑓𝑚𝑞𝑎𝑚𝑟𝑎𝑓𝑝𝑠\left\{\begin{array}[]{c}bemt\\ cfkt\\ aglt\\ dfmq\\ ahmr\\ afps\end{array}\right\}+ {chlqbgpqdgkrceprbhksdels}𝑐𝑙𝑞𝑏𝑔𝑝𝑞𝑑𝑔𝑘𝑟𝑐𝑒𝑝𝑟𝑏𝑘𝑠𝑑𝑒𝑙𝑠\left\{\begin{array}[]{c}chlq\\ bgpq\\ dgkr\\ cepr\\ bhks\\ dels\end{array}\right\}

With the 4×4444\times 4 mutualistic system, there are six tipping cycles in a2^^subscript𝑎2\hat{a_{2}}, and as with the competitive case, each of these are in two tipping cycles in a1^^subscript𝑎1\hat{a_{1}}. However, unlike in the competitive case, there are eight new tipping cycles that have none of the a2^^subscript𝑎2\hat{a_{2}} as subsets. In the next tipping cycle set, a0^^subscript𝑎0\hat{a_{0}}, it follows the compeitive case in having six sets, each of which consists of two sets from a1^^subscript𝑎1\hat{a_{1}}, and six sets that are new configurations (the same new configurations as in the competitive case). In addition, there are eight cycles each of which has as a subset one of the eight new configurations in a1^^subscript𝑎1\hat{a_{1}}. These eight cycles begin what might be called a parallel inclusion pattern, complicating the flow yet further:

a2^^subscript𝑎2\hat{a_{2}} a1^^subscript𝑎1\hat{a_{1}} a0^^subscript𝑎0\hat{a_{0}}
{beckgldqhrps}𝑏𝑒𝑐𝑘𝑔𝑙𝑑𝑞𝑟𝑝𝑠absent\left\{\begin{array}[]{c}be\\ ck\\ gl\\ dq\\ hr\\ ps\end{array}\right\}\subset {bembetcfkcktaglgltdfqdmqahrhmrapsfps}+limit-from𝑏𝑒𝑚𝑏𝑒𝑡𝑐𝑓𝑘𝑐𝑘𝑡𝑎𝑔𝑙𝑔𝑙𝑡𝑑𝑓𝑞𝑑𝑚𝑞𝑎𝑟𝑚𝑟𝑎𝑝𝑠𝑓𝑝𝑠\left\{\begin{array}[]{c}bem\\ bet\\ cfk\\ ckt\\ agl\\ glt\\ dfq\\ dmq\\ ahr\\ hmr\\ aps\\ fps\\ \end{array}\right\}+ {bgkcelbhqcpqdergprdkshls}𝑏𝑔𝑘𝑐𝑒𝑙𝑏𝑞𝑐𝑝𝑞𝑑𝑒𝑟𝑔𝑝𝑟𝑑𝑘𝑠𝑙𝑠absent\left\{\begin{array}[]{c}bgk\\ cel\\ bhq\\ cpq\\ der\\ gpr\\ dks\\ hls\end{array}\right\}\subset {bemtcfktagltdfmqahmrafps}+limit-from𝑏𝑒𝑚𝑡𝑐𝑓𝑘𝑡𝑎𝑔𝑙𝑡𝑑𝑓𝑚𝑞𝑎𝑚𝑟𝑎𝑓𝑝𝑠\left\{\begin{array}[]{c}bemt\\ cfkt\\ aglt\\ dfmq\\ ahmr\\ afps\end{array}\right\}+ {bgktceltbhmqcfpqdemragprdfksahls}+limit-from𝑏𝑔𝑘𝑡𝑐𝑒𝑙𝑡𝑏𝑚𝑞𝑐𝑓𝑝𝑞𝑑𝑒𝑚𝑟𝑎𝑔𝑝𝑟𝑑𝑓𝑘𝑠𝑎𝑙𝑠\left\{\begin{array}[]{c}bgkt\\ celt\\ bhmq\\ cfpq\\ demr\\ agpr\\ dfks\\ ahls\end{array}\right\}+ {chlqbgpqdgkrceprbhksdels}𝑐𝑙𝑞𝑏𝑔𝑝𝑞𝑑𝑔𝑘𝑟𝑐𝑒𝑝𝑟𝑏𝑘𝑠𝑑𝑒𝑙𝑠\left\{\begin{array}[]{c}chlq\\ bgpq\\ dgkr\\ cepr\\ bhks\\ dels\end{array}\right\}

Thus, the differences in the specific sign structure of the community matrices alters the flow of the inclusion properties of the tipping cycle sets as their cycle size increases. A full combinatorial characterisation of the flows in general yields the values reflected in the ai~~subscript𝑎𝑖\tilde{a_{i}} of the different forms, yet in a more intricate way.

For example, in the competitive case, the way each tipping cycle set unfolds as i𝑖i decreases for a given n𝑛n is as follows. For n=8𝑛8n=8, the first a~isubscript~𝑎𝑖\tilde{a}_{i} where ai~>0~subscript𝑎𝑖0\tilde{a_{i}}>0 is |a^6|subscript^𝑎6|\hat{a}_{6}|,

|a^6|=12×8!6!subscript^𝑎61286|\hat{a}_{6}|=\frac{1}{2}\times\frac{8!}{6!}

The sets from |a^6|subscript^𝑎6|\hat{a}_{6}| are then carried, through inclusion, as subsets into |a^5|subscript^𝑎5|\hat{a}_{5}|,

|a^5a^6|=6×|a^6|1subscript^𝑎subscript5subscript^𝑎66subscript^𝑎61|\hat{a}_{5_{\hat{a}_{6}}}|=6\times\frac{|\hat{a}_{6}|}{1}

where the expression |a^5a^6|subscript^𝑎subscript5subscript^𝑎6|\hat{a}_{5_{\hat{a}_{6}}}| indicates the sets first seen in |a^6|subscript^𝑎6|\hat{a}_{6}| now included in the |a^5|subscript^𝑎5|\hat{a}_{5}| sets, and where the value of |a^6|subscript^𝑎6|\hat{a}_{6}| is divided by 111 (the first step in which the set is included), and multiplied by 666 (i.e. i+1𝑖1i+1, the coefficient index of the smaller (in set size), preceding set).

In the case of competitive systems, we know that the number of tipping cycle sets for each aisubscript𝑎𝑖a_{i} is 12×n!i!12𝑛𝑖\frac{1}{2}\times\frac{n!}{i!}, which for i=5𝑖5i=5 (n=8𝑛8n=8) equals the value of |a^5a^6|subscript^𝑎subscript5subscript^𝑎6|\hat{a}_{5_{\hat{a}_{6}}}|. Therefore there are no new additional sets arising in |a^5|subscript^𝑎5|\hat{a}_{5}| that are not supersets of |a^6|subscript^𝑎6|\hat{a}_{6}|.

The next coefficient consists of

|a^4a^6|=5×|a^5a^6|2subscript^𝑎subscript4subscript^𝑎65subscript^𝑎subscript5subscript^𝑎62|\hat{a}_{4_{\hat{a}_{6}}}|=5\times\frac{|\hat{a}_{5_{\hat{a}_{6}}}|}{2}

again, with |a^5a^6|subscript^𝑎subscript5subscript^𝑎6|\hat{a}_{5_{\hat{a}_{6}}}| divided by 222 (the second step from |a^6|subscript^𝑎6|\hat{a}_{6}|), and multiplied by 555 (i+1𝑖1i+1).

In addition to any supersets of |a^6|subscript^𝑎6|\hat{a}_{6}| (via |a^5a^6|subscript^𝑎subscript5subscript^𝑎6|\hat{a}_{5_{\hat{a}_{6}}}|), there are a number of newly formed sets (|a^4a^4|subscript^𝑎subscript4subscript^𝑎4|\hat{a}_{4_{\hat{a}_{4}}}|) easily calculated from the total number of sets,

|a^4a^4|=12×8!4!|a^4a^6|subscript^𝑎subscript4subscript^𝑎41284subscript^𝑎subscript4subscript^𝑎6|\hat{a}_{4_{\hat{a}_{4}}}|=\frac{1}{2}\times\frac{8!}{4!}-|\hat{a}_{4_{\hat{a}_{6}}}|

Therefore,

|a^4|=|a^4a^6|+|a^4a^4|.subscript^𝑎4subscript^𝑎subscript4subscript^𝑎6subscript^𝑎subscript4subscript^𝑎4|\hat{a}_{4}|=|\hat{a}_{4_{\hat{a}_{6}}}|+|\hat{a}_{4_{\hat{a}_{4}}}|.

This process can continue as i𝑖i decreases as follows,

|a^3a^6|=4×|a^4a^6|3,|a^3a^4|=4×|a^4a^4|1formulae-sequencesubscript^𝑎subscript3subscript^𝑎64subscript^𝑎subscript4subscript^𝑎63subscript^𝑎subscript3subscript^𝑎44subscript^𝑎subscript4subscript^𝑎41|\hat{a}_{3_{\hat{a}_{6}}}|=4\times\frac{|\hat{a}_{4_{\hat{a}_{6}}}|}{3},|\hat{a}_{3_{\hat{a}_{4}}}|=4\times\frac{|\hat{a}_{4_{\hat{a}_{4}}}|}{1}

where again the denominator indicates the number of steps away from the original set construction,

|a^3a^3|=12×8!3!|a^3a^6||a^3a^4|subscript^𝑎subscript3subscript^𝑎31283subscript^𝑎subscript3subscript^𝑎6subscript^𝑎subscript3subscript^𝑎4|\hat{a}_{3_{\hat{a}_{3}}}|=\frac{1}{2}\times\frac{8!}{3!}-|\hat{a}_{3_{\hat{a}_{6}}}|-|\hat{a}_{3_{\hat{a}_{4}}}|

and

|a^3|=|a^3a^6|+|a^3a^4|+|a^3a^3|.subscript^𝑎3subscript^𝑎subscript3subscript^𝑎6subscript^𝑎subscript3subscript^𝑎4subscript^𝑎subscript3subscript^𝑎3|\hat{a}_{3}|=|\hat{a}_{3_{\hat{a}_{6}}}|+|\hat{a}_{3_{\hat{a}_{4}}}|+|\hat{a}_{3_{\hat{a}_{3}}}|.

Continuing,

|a^2a^6|=3×|a^3a^6|4,|a^2a^4|=3×|a^3a^4|2,|a^2a^3|=3×|a^3a^3|1formulae-sequencesubscript^𝑎subscript2subscript^𝑎63subscript^𝑎subscript3subscript^𝑎64formulae-sequencesubscript^𝑎subscript2subscript^𝑎43subscript^𝑎subscript3subscript^𝑎42subscript^𝑎subscript2subscript^𝑎33subscript^𝑎subscript3subscript^𝑎31|\hat{a}_{2_{\hat{a}_{6}}}|=3\times\frac{|\hat{a}_{3_{\hat{a}_{6}}}|}{4},|\hat{a}_{2_{\hat{a}_{4}}}|=3\times\frac{|\hat{a}_{3_{\hat{a}_{4}}}|}{2},|\hat{a}_{2_{\hat{a}_{3}}}|=3\times\frac{|\hat{a}_{3_{\hat{a}_{3}}}|}{1}
|a^2a^2|=12×8!2!|a^2a^6||a^2a^4||a^2a^3|subscript^𝑎subscript2subscript^𝑎21282subscript^𝑎subscript2subscript^𝑎6subscript^𝑎subscript2subscript^𝑎4subscript^𝑎subscript2subscript^𝑎3|\hat{a}_{2_{\hat{a}_{2}}}|=\frac{1}{2}\times\frac{8!}{2!}-|\hat{a}_{2_{\hat{a}_{6}}}|-|\hat{a}_{2_{\hat{a}_{4}}}|-|\hat{a}_{2_{\hat{a}_{3}}}|
|a^2|=|a^2a^6|+|a^2a^4|+|a^2a^3|+|a^2a^2|subscript^𝑎2subscript^𝑎subscript2subscript^𝑎6subscript^𝑎subscript2subscript^𝑎4subscript^𝑎subscript2subscript^𝑎3subscript^𝑎subscript2subscript^𝑎2|\hat{a}_{2}|=|\hat{a}_{2_{\hat{a}_{6}}}|+|\hat{a}_{2_{\hat{a}_{4}}}|+|\hat{a}_{2_{\hat{a}_{3}}}|+|\hat{a}_{2_{\hat{a}_{2}}}|

and so on, down to a0subscript𝑎0a_{0},

|a^1a^6|=2×|a^2a^6|5,|a^1a^4|=2×|a^2a^4|3,|a^1a^3|=2×|a^2a^3|2,|a^1a^2|=2×|a^2a^2|1formulae-sequencesubscript^𝑎subscript1subscript^𝑎62subscript^𝑎subscript2subscript^𝑎65formulae-sequencesubscript^𝑎subscript1subscript^𝑎42subscript^𝑎subscript2subscript^𝑎43formulae-sequencesubscript^𝑎subscript1subscript^𝑎32subscript^𝑎subscript2subscript^𝑎32subscript^𝑎subscript1subscript^𝑎22subscript^𝑎subscript2subscript^𝑎21|\hat{a}_{1_{\hat{a}_{6}}}|=2\times\frac{|\hat{a}_{2_{\hat{a}_{6}}}|}{5},|\hat{a}_{1_{\hat{a}_{4}}}|=2\times\frac{|\hat{a}_{2_{\hat{a}_{4}}}|}{3},|\hat{a}_{1_{\hat{a}_{3}}}|=2\times\frac{|\hat{a}_{2_{\hat{a}_{3}}}|}{2},|\hat{a}_{1_{\hat{a}_{2}}}|=2\times\frac{|\hat{a}_{2_{\hat{a}_{2}}}|}{1}
|a^1a^1|=12×8!1!|a^1a^6||a^1a^4||a^1a^3||a^1a^2|subscript^𝑎subscript1subscript^𝑎11281subscript^𝑎subscript1subscript^𝑎6subscript^𝑎subscript1subscript^𝑎4subscript^𝑎subscript1subscript^𝑎3subscript^𝑎subscript1subscript^𝑎2|\hat{a}_{1_{\hat{a}_{1}}}|=\frac{1}{2}\times\frac{8!}{1!}-|\hat{a}_{1_{\hat{a}_{6}}}|-|\hat{a}_{1_{\hat{a}_{4}}}|-|\hat{a}_{1_{\hat{a}_{3}}}|-|\hat{a}_{1_{\hat{a}_{2}}}|
|a^1|=|a^1a^6|+|a^1a^4|+|a^1a^3|+|a^1a^2|+|a^1a^1|subscript^𝑎1subscript^𝑎subscript1subscript^𝑎6subscript^𝑎subscript1subscript^𝑎4subscript^𝑎subscript1subscript^𝑎3subscript^𝑎subscript1subscript^𝑎2subscript^𝑎subscript1subscript^𝑎1|\hat{a}_{1}|=|\hat{a}_{1_{\hat{a}_{6}}}|+|\hat{a}_{1_{\hat{a}_{4}}}|+|\hat{a}_{1_{\hat{a}_{3}}}|+|\hat{a}_{1_{\hat{a}_{2}}}|+|\hat{a}_{1_{\hat{a}_{1}}}|
|a^0a^6|=|a^1a^6|6,|a^0a^4|=|a^1a^4|4,|a^0a^3|=|a^1a^3|3,|a^0a^2|=|a^1a^2|2,|a^0a^1|=|a^1a^1|1formulae-sequencesubscript^𝑎subscript0subscript^𝑎6subscript^𝑎subscript1subscript^𝑎66formulae-sequencesubscript^𝑎subscript0subscript^𝑎4subscript^𝑎subscript1subscript^𝑎44formulae-sequencesubscript^𝑎subscript0subscript^𝑎3subscript^𝑎subscript1subscript^𝑎33formulae-sequencesubscript^𝑎subscript0subscript^𝑎2subscript^𝑎subscript1subscript^𝑎22subscript^𝑎subscript0subscript^𝑎1subscript^𝑎subscript1subscript^𝑎11|\hat{a}_{0_{\hat{a}_{6}}}|=\frac{|\hat{a}_{1_{\hat{a}_{6}}}|}{6},|\hat{a}_{0_{\hat{a}_{4}}}|=\frac{|\hat{a}_{1_{\hat{a}_{4}}}|}{4},|\hat{a}_{0_{\hat{a}_{3}}}|=\frac{|\hat{a}_{1_{\hat{a}_{3}}}|}{3},|\hat{a}_{0_{\hat{a}_{2}}}|=\frac{|\hat{a}_{1_{\hat{a}_{2}}}|}{2},|\hat{a}_{0_{\hat{a}_{1}}}|=\frac{|\hat{a}_{1_{\hat{a}_{1}}}|}{1}
|a^0a^0|=12×8!0!|a^1a^6||a^1a^4||a^1a^3||a^1a^2||a^1a^1|subscript^𝑎subscript0subscript^𝑎01280subscript^𝑎subscript1subscript^𝑎6subscript^𝑎subscript1subscript^𝑎4subscript^𝑎subscript1subscript^𝑎3subscript^𝑎subscript1subscript^𝑎2subscript^𝑎subscript1subscript^𝑎1|\hat{a}_{0_{\hat{a}_{0}}}|=\frac{1}{2}\times\frac{8!}{0!}-|\hat{a}_{1_{\hat{a}_{6}}}|-|\hat{a}_{1_{\hat{a}_{4}}}|-|\hat{a}_{1_{\hat{a}_{3}}}|-|\hat{a}_{1_{\hat{a}_{2}}}|-|\hat{a}_{1_{\hat{a}_{1}}}|
|a^0|=|a^0a^6|+|a^0a^4|+|a^0a^3|+|a^0a^2|+|a^0a^1|+|a^0a^0|subscript^𝑎0subscript^𝑎subscript0subscript^𝑎6subscript^𝑎subscript0subscript^𝑎4subscript^𝑎subscript0subscript^𝑎3subscript^𝑎subscript0subscript^𝑎2subscript^𝑎subscript0subscript^𝑎1subscript^𝑎subscript0subscript^𝑎0|\hat{a}_{0}|=|\hat{a}_{0_{\hat{a}_{6}}}|+|\hat{a}_{0_{\hat{a}_{4}}}|+|\hat{a}_{0_{\hat{a}_{3}}}|+|\hat{a}_{0_{\hat{a}_{2}}}|+|\hat{a}_{0_{\hat{a}_{1}}}|+|\hat{a}_{0_{\hat{a}_{0}}}|

In general, for competitive systems, and a given n𝑛n,

|a^n2|=12n!(n2)!subscript^𝑎𝑛212𝑛𝑛2|\hat{a}_{n-2}|=\frac{1}{2}\frac{n!}{(n-2)!}

and for i<n2𝑖𝑛2i<n-2, for individual supersets derived from smaller a^jsubscript^𝑎𝑗\hat{a}_{j} sets, each smaller set is divided by the number of steps (ji𝑗𝑖j-i) removed from their original construction (at index j𝑗j) and the whole expression multiplied by i+1𝑖1i+1,

|a^ia^j|=(i+1)×|a^i+1a^j|ji.subscript^𝑎subscript𝑖subscript^𝑎𝑗𝑖1subscript^𝑎𝑖subscript1subscript^𝑎𝑗𝑗𝑖|\hat{a}_{i_{\hat{a}_{j}}}|=(i+1)\times\frac{|\hat{a}_{{i+1}_{\hat{a}_{j}}}|}{j-i}.

Therefore, for a given index i𝑖i the supersets are

Ωi=(i+1)×j=i+1,k=1j=n2,k=n2i|a^i+1a^j|ksubscriptΩ𝑖𝑖1superscriptsubscriptformulae-sequence𝑗𝑖1𝑘1formulae-sequence𝑗𝑛2𝑘𝑛2𝑖subscript^𝑎𝑖subscript1subscript^𝑎𝑗𝑘\Omega_{i}=(i+1)\times\sum_{j=i+1,k=1}^{j=n-2,k=n-2-i}\frac{|\hat{a}_{{i+1}_{\hat{a}_{j}}}|}{k}

while the number of newly formed sets in each i𝑖i that are not supersets are,

Γi=12n!i!Ωi.subscriptΓ𝑖12𝑛𝑖subscriptΩ𝑖\Gamma_{i}=\frac{1}{2}\frac{n!}{i!}-\Omega_{i}.

The ΓisubscriptΓ𝑖\Gamma_{i} values for competitive systems up to n=12𝑛12n=12 are shown in Table 3. Each |a^i|subscript^𝑎𝑖|\hat{a}_{i}|, consisting of the cumulative supersets and the newly formed sets, is then

|a^i|=Ωi+Γi.subscript^𝑎𝑖subscriptΩ𝑖subscriptΓ𝑖|\hat{a}_{i}|=\Omega_{i}+\Gamma_{i}.

While the ΩisubscriptΩ𝑖\Omega_{i} follows the same patterning for mutualistic and predator-prey systems (one difference with these two forms is that Γn30subscriptΓ𝑛30\Gamma_{n-3}\neq 0, unlike with the competitive case), a natural question arises as to what a full characterisation of the ΩisubscriptΩ𝑖\Omega_{i} and ΓisubscriptΓ𝑖\Gamma_{i} for any n×n𝑛𝑛n\times n system with any sign structure might suggest. That is, whether there is a meaningful relation between the combinatorial structure of the destabilising sets and the general stability properties of systems based on their sign structure.

n𝑛n a8subscript𝑎8a_{8} a7subscript𝑎7a_{7} a6subscript𝑎6a_{6} a5subscript𝑎5a_{5} a4subscript𝑎4a_{4} a3subscript𝑎3a_{3} a2subscript𝑎2a_{2} a1subscript𝑎1a_{1} a0subscript𝑎0a_{0}
444 6
555 30 20
666 90 120 135
777 210 420 945 924
888 420 1120 3780 7392 7420
999 756 2520 11340 33264 66780 66744
101010 1260 5040 28350 110880 333900 667440 667485
111111 1980 9240 62370 304920 1224300 3670920 7342335 7342280
121212 2970 15840 124740 731808 3672900 14683680 44054010 88107360 88107426
Table 3: Table 3 Values of ΓisubscriptΓ𝑖\Gamma_{i} for each |a^i|subscript^𝑎𝑖|\hat{a}_{i}| for competitive systems up to n=12𝑛12n=12. There is rich structure among the ΓisubscriptΓ𝑖\Gamma_{i}. For example, the a0subscript𝑎0a_{0} values ({6,20,135,924,}620135924\{6,20,135,924,...\}) are the rencontres numbers with two fixed points; the first entries for each n𝑛n ({α4,α5,α6,α7,}={6,30,90,210,}subscript𝛼4subscript𝛼5subscript𝛼6subscript𝛼763090210\{\alpha_{4},\alpha_{5},\alpha_{6},\alpha_{7},...\}=\{6,30,90,210,...\}) are n(n1)(n2)(n3)/4𝑛𝑛1𝑛2𝑛34n(n-1)(n-2)(n-3)/4 (or αn=αn1+(n1)(n2)(n3)subscript𝛼𝑛subscript𝛼𝑛1𝑛1𝑛2𝑛3\alpha_{n}=\alpha_{n-1}+(n-1)(n-2)(n-3)); the second set of values ({β5,β6,β7,β8,}={20,120,420,1120,}subscript𝛽5subscript𝛽6subscript𝛽7subscript𝛽8201204201120\{\beta_{5},\beta_{6},\beta_{7},\beta_{8},...\}=\{20,120,420,1120,...\}) in each n𝑛n can be described as βn=βn1+(n1)(2(n23)+(n2)(n32))subscript𝛽𝑛subscript𝛽𝑛1𝑛12binomial𝑛23𝑛2binomial𝑛32\beta_{n}=\beta_{n-1}+(n-1)(2\binom{n-2}{3}+(n-2)\binom{n-3}{2}); the third set of values ({δ6,δ7,δ8,δ9,}={135,945,3780,11340,}subscript𝛿6subscript𝛿7subscript𝛿8subscript𝛿9135945378011340\{\delta_{6},\delta_{7},\delta_{8},\delta_{9},...\}=\{135,945,3780,11340,...\}) is δn=δn1+(n1)(((n32)2)+(n2)(n3)!(n6)!)subscript𝛿𝑛subscript𝛿𝑛1𝑛1binomialbinomial𝑛322𝑛2𝑛3𝑛6\delta_{n}=\delta_{n-1}+(n-1)(\binom{\binom{n-3}{2}}{2}+(n-2)\frac{(n-3)!}{(n-6)!}).

References

[1] B. Brooks, The coefficients of the characteristic polynomial in terms of the eigenvalues and the elements of an n×n𝑛𝑛n\times n matrix, Appl. Math. Lett., 19:511–515, 2006.

[2] W. Geary, M. Bode, T. Doherty, E. Fulton, D. Nimmo, A. Tulloch, V. Tulloch, and E. Ritchie, A guide to ecosystem models and their environmental applications, Nat. Ecol. Evol., 4(11):1459-1471, 2020.

[3] A. Hurwitz, Über die bedingungen, unter welchen eine gleichung nur wurzeln mit negativen reellen theilen besitzt, Math. Ann., 46:273–284, 1895.

[4] A. Lotka, Elements of physical biology, Williams and Wilkins, Baltimore, Maryland, 1925.

[5] N. Obrechkoff, Sur un problème de Laguerre. C.R. Acd. Sci. Paris, 177:223-235, 1923.

[6] E. Routh, Treatise on the Stability of a Given State of Motion: Particularly Steady Motion, Macmillan and Co., London, 1877.

[7] N. Sloane, The on-line encyclopedia of integer sequences, https://oeis.org/.

[8] V. Volterra, Variazioni e fluttuazioni del numero d’individui in specie animali conviventi, Mem. Acad. Lincei Roma., 2:31–113, 1926.