Equational Reasoning for MTL Type Classes

Härmel Nestra harmel.nestra@ut.ee https://orcid.org/0000-0001-7050-7171 University of TartuInstitute of Computer ScienceNarva Rd. 18Tartu51009Estonia
Abstract.

Ability to use definitions occurring in the code directly in equational reasoning is one of the key strengths of functional programming. This is impossible in the case of Haskell type class methods unless a particular instance type is specified, since class methods can be defined differently for different instances. To allow uniform reasoning for all instances, many type classes in the Haskell library come along with laws (axioms), specified in comments, that all instances are expected to follow (albeit Haskell is unable to force it). For the type classes introduced in the Monad Transformer Library (MTL), such laws have not been specified; nevertheless, some sets of axioms have occurred in the literature and the Haskell mailing lists. This paper investigates sets of laws usable for equational reasoning about methods of the type classes 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader} and 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} and also reviews analogous earlier proposals for the classes 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError} and 𝑀𝑜𝑛𝑎𝑑𝑆𝑡𝑎𝑡𝑒𝑀𝑜𝑛𝑎𝑑𝑆𝑡𝑎𝑡𝑒\mathit{MonadState}. For both 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader} and 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter}, an equivalence result of two alternative axiomatizations in terms of different sets of operations is established. As a sideline, patterns in the choice of methods of different classes are noticed which may inspire new developments in MTL.

monad transformers, equational reasoning
conference: ; ; ccs: Software and its engineering Semanticsccs: Software and its engineering Software libraries and repositoriesccs: Software and its engineering Designing softwareccs: Software and its engineering Formal software verificationccs: Theory of computation Formalismsccs: Theory of computation Equational logic and rewritingccs: Theory of computation Program semantics

1. Introduction

Equational reasoning is often presented as one of the key benefits of functional programming. Definitions in the source code provide us basic equalities to rely on, and referential transparency in pure functional languages like Haskell allows one to safely replace terms by equal terms within any context. Definitional equality works like in mathematics.

As Haskell type class methods are defined newly for every instance type, equational reasoning relying on method definitions in the code is type specific. In order to create uniform proofs for all instances of a class, one must use assumptions in the form of equations, called axioms or laws, which are not grounded on the source code. Many type classes defined in the Haskell library come along with such axioms which every instance of the class is supposed (though not forced) to satisfy. For example, the method 𝑓𝑚𝑎𝑝𝑓𝑚𝑎𝑝\mathit{fmap} of all instances of the class 𝐹𝑢𝑛𝑐𝑡𝑜𝑟𝐹𝑢𝑛𝑐𝑡𝑜𝑟\mathit{Functor} is supposed to preserve composition and identities, the methods of the class 𝑀𝑜𝑛𝑎𝑑𝑀𝑜𝑛𝑎𝑑\mathit{Monad} should satisfy the standard monad laws of category theory, etc.

The class 𝑀𝑜𝑛𝑎𝑑𝑀𝑜𝑛𝑎𝑑\mathit{Monad} offers a uniform interface for effectful computations of various kinds. The Monad Transformer Library (MTL) which is a part of GHC standard libraries provides a lot of subclasses of 𝑀𝑜𝑛𝑎𝑑𝑀𝑜𝑛𝑎𝑑\mathit{Monad} with specific operation interfaces for different effects. It implements a classic approach dating back to Liang et al. (DBLP:conf/popl/LiangHJ95), Jones (DBLP:conf/afp/Jones95) and Hutton and Meijer (HuttonM1996), yet its type classes have no universally accepted laws for equational reasoning. Gibbons and Hinze (DBLP:conf/icfp/GibbonsH11) advocate equational reasoning for effectful computations, in particular in the case of some MTL classes, but without analyzing the choice of the laws or studying alternatives.

Recently, laws for MTL type classes have gained some attention in research (DBLP:journals/corr/abs-1810-13430; DBLP:conf/ictac/Nestra19; DBLP:conf/mpc/AffeldtNS19) and in Haskell Libraries mailing list (Libraries) which tells about rising interest in this topic. This paper studies several equational axiomatizations of monadic computations with various effects—exceptions, environment, logging (writer) and mutable state. For environment and logging, we propose a few alternative sets of laws, prove their equivalence, and prove correctness of these laws for monads built up using the exception, reader, writer and state monad transformers. For exceptions and state, we review similar results of previous work. The axiomatics considered here address one effect each; axiomatizing of combinations of different effects might be an interesting topic of future work.

We avoid a premature conclusion to have found “the right axiomatizations” for the four type classes. Firstly, validity on four types of effects might not provide sufficient evidence for declaring the laws universal enough. Secondly, some of our axioms assume operations with types that are impossible in MTL. Nevertheless, such sets of axioms can be useful for proving equivalences of legal programs. Providing a means for writing such proofs is the primary goal of developing the axiomatizations. Solving problems by going beyond the bounds imposed by the problem setting is neither unsound nor original. Quite analogously to our case, Hutton and Fulger (Hutton08reasoningabout) lift type restrictions imposed by the context in their proofs of equivalences of effectful programs.

Like in (DBLP:conf/icfp/GibbonsH11), we ignore partiality that may break the laws (see Jeuring et al. (DBLP:conf/haskell/JeuringJA12) for proof that the state monad transformer does not preserve monad laws for bottom cases, and Huffman (DBLP:conf/icfp/Huffman12) for similar results for the exception and writer monad transformer). Danielsson et al. (DBLP:conf/popl/DanielssonHJG06) show that ignoring partiality in equational reasoning is justified. We use notation from category theory throughout the paper mainly for achieving more concise formulae rather than for generality. Most results are established for category 𝑺𝒆𝒕fragmentsSet\boldsymbol{Set} only.

In Sect. 2, we help the reader with preliminaries from category theory; Sect. 3 gives a short introduction to MTL. In Sect. 4, we review previous work on laws of exceptions. In Sect. 5, we study axiomatics for equational reasoning about reader monad operations. Section 6 is devoted to writer monads. We develop an abstract treatment of monads equipped with some additional operations in general category theoretical setting, which luckily applies to the writer case. The set of operations most natural for investigating at the abstract level does not coincide with the actual method set specified in MTL but, as the latter is directly expressible in terms of the former, the results are applicable to Haskell. Section 7 contains a brief review of previously proposed axiomatics of stateful computations. Section LABEL:conc concludes.

2. Preliminaries from Category Theory

In mathematics, a category consists of a collection of objects, along with a collection of morphisms working between every ordered pair of objects, satisfying the following properties:

  • For every object X𝑋X, there exists a distinguished morphism idXfragmentsid𝑋{\operator@font id}_{X} from X𝑋X to X𝑋X called the identity of X𝑋X;

  • For every triple (X,Y,Z)fragments(X,Y,Z)(X,Y,Z) of objects and morphisms f𝑓f from X𝑋X to Y𝑌Y and g𝑔g from Y𝑌Y to Z𝑍Z, there exists a morphism gffragmentsgfg\circ f from X𝑋X to Z𝑍Z called the composition of f𝑓f and g𝑔g;

  • The composition as an operation is associative, and each identity morphism idXfragmentsid𝑋{\operator@font id}_{X} works as both a left and right unit of composition.

The claim that f𝑓f is a morphism from object X𝑋X to object Y𝑌Y is denoted by f:XYfragmentsf:XYf:X\to Y, where XYfragmentsXYX\to Y is sometimes called the type of f𝑓f. The object in the subscript of idid{\operator@font id} can be omitted if determined by the context. Assume the binding precedence of \circ being higher than that of any other binary operator.

It is common to use notions of category theory when talking about Haskell. The data types are playing the role of objects and definable functions from one type to another are the morphisms between these types as objects. Identity functions and function composition play the corresponding role. Laziness of Haskell, along with the presence of 𝑠𝑒𝑞𝑠𝑒𝑞\mathit{seq}, does not allow all properties of category to be fully satisfied, nor do the standard categorical constructions in Haskell (some of which are introduced below) fully meet their definition given in category theory; however, as shown by Danielsson et al. (DBLP:conf/popl/DanielssonHJG06), it is justified to ignore the deviations for practical purposes. We will use both the notation of Haskell and that of category theory throughout the paper, depending on which is more concise and readable at a particular place.

Pair types (x,y)fragments(x,y)(\mathit{x},\mathit{y}) of Haskell correspond to the binary products in category theory where they are denoted by cross. In category theory, a product X×YfragmentsXYX\times Y of objects X𝑋X and Y𝑌Y comes along with morphisms exl:X×YXfragmentsexl:XYX{\operator@font exl}:X\times Y\to X, exr:X×YYfragmentsexr:XYY{\operator@font exr}:X\times Y\to Y and an operator \both mapping every pair of morphisms f:ZXfragmentsf:ZXf:Z\to X and g:ZYfragmentsg:ZYg:Z\to Y to a morphism fg:ZX×Yfragmentsfg:ZXYf\both g:Z\to X\times Y. Thereby, they must meet the laws exl(fg)=ffragmentsexl(fg)f{\operator@font exl}\circ(f\both g)=f, exr(fg)=gfragmentsexr(fg)g{\operator@font exr}\circ(f\both g)=g and exlhexrh=hfragmentsexlhexrhh{\operator@font exl}\circ h\both{\operator@font exr}\circ h=h. In Haskell, the projection functions 𝑓𝑠𝑡𝑓𝑠𝑡\mathit{fst} and 𝑠𝑛𝑑𝑠𝑛𝑑\mathit{snd} stand for exlexl{\operator@font exl} and exrexr{\operator@font exr}; for fgfragmentsfgf\both g one can take the function that applies both f𝑓f and g𝑔g to its argument and returns the results as a pair.

Similarly, the types 𝐸𝑖𝑡ℎ𝑒𝑟xyfragmentsEitherxy\mathit{Either}\;\mathit{x}\;\mathit{y} of Haskell correspond to binary sums of category theory where they are written by plus. A sum X+YfragmentsXYX+Y of objects comes along with morphisms inl:XX+Yfragmentsinl:XXY{\operator@font inl}:X\to X+Y, inr:YX+Yfragmentsinr:YXY{\operator@font inr}:Y\to X+Y and an operator \either that maps every pair of morphisms f:XZfragmentsf:XZf:X\to Z and g:YZfragmentsg:YZg:Y\to Z to a morphism fg:X+YZfragmentsfg:XYZf\either g:X+Y\to Z. Thereby, they must satisfy the equations (fg)inl=ffragments(fg)inlf(f\either g)\circ{\operator@font inl}=f, (fg)inr=gfragments(fg)inrg(f\either g)\circ{\operator@font inr}=g and hinlhinr=hfragmentshinlhinrhh\circ{\operator@font inl}\either h\circ{\operator@font inr}=h. In Haskell, inlinl{\operator@font inl} and inrinr{\operator@font inr} are written as 𝐿𝑒𝑓𝑡𝐿𝑒𝑓𝑡\mathit{Left} and 𝑅𝑖𝑔ℎ𝑡𝑅𝑖𝑔ℎ𝑡\mathit{Right}, whereas the intended behavior of \either is captured by the library function 𝑒𝑖𝑡ℎ𝑒𝑟𝑒𝑖𝑡ℎ𝑒𝑟\mathit{either}.

The 𝐹𝑢𝑛𝑐𝑡𝑜𝑟𝐹𝑢𝑛𝑐𝑡𝑜𝑟\mathit{Functor} type class in Haskell is introduced by


\pboxed\column

B@¿l¡@\column5@¿l¡@\columnE@¿l¡@ [B]classFunctorfwhere\<[E]
 [B] \<[5] [5]fmap::(ab)→fafb\<[E]
 [B] \<[5] [5] {-… other stuff omitted … -} \<[E]\endpboxed


In category theory, a functor F𝐹F is a structure-preserving mapping between categories, i.e., a mapping of objects of one category to objects of the other category and morphisms of type XYfragmentsXYX\to Y for any objects X,YfragmentsX,YX,Y of the first category to morphisms of type FXFYfragmentsFXFYF\,X\to F\,Y in the second category, satisfying the laws Fid=idfragmentsFididF\,{\operator@font id}={\operator@font id} and F(gf)=FgFffragmentsF(gf)FgFfF\,(g\circ f)=F\,g\circ F\,f. The Haskell class method 𝑓𝑚𝑎𝑝𝑓𝑚𝑎𝑝\mathit{fmap} corresponds to the mapping of morphisms while the mapping of objects is implemented by the type constructor f𝑓\mathit{f}. The two functor laws are expected to be fulfilled by every instance of the 𝐹𝑢𝑛𝑐𝑡𝑜𝑟𝐹𝑢𝑛𝑐𝑡𝑜𝑟\mathit{Functor} type class.

The library of Haskell defines also the class 𝐵𝑖𝑓𝑢𝑛𝑐𝑡𝑜𝑟𝐵𝑖𝑓𝑢𝑛𝑐𝑡𝑜𝑟\mathit{Bifunctor} analogous to 𝐹𝑢𝑛𝑐𝑡𝑜𝑟𝐹𝑢𝑛𝑐𝑡𝑜𝑟\mathit{Functor} but applying to binary type constructors:


\pboxed\column

B@¿l¡@\column5@¿l¡@\columnE@¿l¡@ [B]classBifunctorpwhere\<[E]
 [B] \<[5] [5]bimap::(ab)→(cd)→pacpbd\<[E]
 [B] \<[5] [5] {-… other stuff omitted … -} \<[E]\endpboxed


The functor laws are assumed to hold for both argument types. In category theory, bifunctors can be seen as functors whose domain is the direct product of two categories. Both the binary product and binary sum, considered above as operations on objects, can be extended to morphisms by defining f×g=fexlgexrfragmentsfgfexlgexrf\times g=f\circ{\operator@font exl}\both g\circ{\operator@font exr} and f+g=inlfinrgfragmentsfginlfinrgf+g={\operator@font inl}\circ f\either{\operator@font inr}\circ g, as the result of which one obtains bifunctors.

A transformation between functors F𝐹F and G𝐺G is a family τ𝜏\tau of morphisms τX:FXGXfragmentsτ𝑋:FXGX\tau_{X}:F\,X\to G\,X for every object X𝑋X. In the programming point of view, transformations are polymorphic functions. A transformation is called natural if it preserves structure embedded in the functors, i.e., satisfies for every morphism f𝑓f the equation τFf=GfτfragmentsτFfGfτ\tau\circ F\,f=G\,f\circ\tau. Like in the case of identity morphisms (which altogether constitute, of course, a natural transformation between I𝐼I and I𝐼I where I𝐼I is the identity functor leaving everything in place), the subscript of τ𝜏\tau is omitted when it is clear from context.

The 𝑀𝑜𝑛𝑎𝑑𝑀𝑜𝑛𝑎𝑑\mathit{Monad} type class which is a subclass of 𝐹𝑢𝑛𝑐𝑡𝑜𝑟𝐹𝑢𝑛𝑐𝑡𝑜𝑟\mathit{Functor} declares methods


\pboxed\column

B@¿l¡@\column5@¿l¡@\column13@¿c¡@\column13E@l@\column17@¿l¡@\column30@¿l¡@\column36@¿l¡@\columnE@¿l¡@ [5](¿​​​¿=)\<[13] [13]::\<[13E] [17]ma→(amb)\<[36] [36]→mb\<[E]
 [5](¿​​​¿)\<[13] [13]::\<[13E] [17]ma\<[30] [30]mb\<[36] [36]→mb\<[E]
 [5]return\<[13] [13]::\<[13E] [17]ama\<[E]\endpboxed


along with the default definition x>>k=x>>=λ kfragmentsxfragmentskxfragmentsλ k\mathit{x}\mathbin{>\!\!\!>}\mathit{k}\mathrel{=}\mathit{x}\mathbin{>\!\!\!>\mkern-6.7mu=}\lambda\kern 0.59998pt\vbox{\hrule width=5.0pt}\to\mathit{k}; the type variable m𝑚\mathit{m} stands for arbitrary instance type of 𝑀𝑜𝑛𝑎𝑑𝑀𝑜𝑛𝑎𝑑\mathit{Monad}. The operator >>=fragments\mathbin{>\!\!\!>\mkern-6.7mu=} is pronounced bind, whereas 𝑟𝑒𝑡𝑢𝑟𝑛𝑟𝑒𝑡𝑢𝑟𝑛\mathit{return} is called unit of the monad. In category theory, bind is usually denoted by (_)fragments(_)(\_)^{*} and the order of its arguments is reversed; so if M𝑀M is a monad then (_)fragments(_)(\_)^{*} maps morphisms of type XMYfragmentsXMYX\to M\,Y to morphisms of type MXMYfragmentsMXMYM\,X\to M\,Y. The Haskell operator >>fragments\mathbin{>\!\!\!>} is a special case of bind with constant function as argument.

In category theory, monad operations must satisfy the unit laws kreturn=kfragmentskreturnkk^{*}\circ{\operator@font return}=k and return=idfragmentsreturnid{\operator@font return}^{*}={\operator@font id} along with associativity lk=(lk)fragmentslk(lk)l^{*}\circ k^{*}=(l^{*}\circ k)^{*}, and the functor must be expressible via monad operations by Mf=(returnf)fragmentsMf(returnf)M\,f=({\operator@font return}\circ f)^{*}. The same axioms are expected to be met by all instances of the 𝑀𝑜𝑛𝑎𝑑𝑀𝑜𝑛𝑎𝑑\mathit{Monad} type class. Category theorists often define monads via join:MMXMXfragmentsjoin:MMXMX{\operator@font join}:M\,M\,X\to M\,X instead of bind. The join and bind operations are expressed in terms of each other by join=idfragmentsjoinid{\operator@font join}={\operator@font id}^{*} and k=joinMkfragmentskjoinMkk^{*}={\operator@font join}\circ M\,k. The axiom set for this approach equivalent to the one given above consists of:

  • The two functor laws for M𝑀M;

  • The naturality laws returnf=MfreturnfragmentsreturnfMfreturn{\operator@font return}\circ f=M\,f\circ{\operator@font return} and joinMMf=MfjoinfragmentsjoinMMfMfjoin{\operator@font join}\circ M\,M\,f=M\,f\circ{\operator@font join};

  • The coherence axioms joinMjoin=joinjoinfragmentsjoinMjoinjoinjoin{\operator@font join}\circ M\,{\operator@font join}={\operator@font join}\circ{\operator@font join},joinMreturn=idfragmentsjoinMreturnid{\operator@font join}\circ M\,{\operator@font return}={\operator@font id} and joinreturn=idfragmentsjoinreturnid{\operator@font join}\circ{\operator@font return}={\operator@font id}.

The morphisms returnreturn{\operator@font return} and joinjoin{\operator@font join} are usually denoted by η𝜂\eta and μ𝜇\mu, respectively. Identity monad I𝐼I is the simplest monad where the mapping of objects, mappings of morphisms, monad unit, bind and join are all identities.

Relative monads on a base functor J𝐽J were introduced by Altenkirch et al. (DBLP:conf/fossacs/AltenkirchCU10; DBLP:journals/corr/AltenkirchCU14). Relative monads are pairs of functors (J,M)fragments(J,M)(J,M) equipped with bind and unit operations whose types are more general than those of the corresponding monad operations: namely, the unit must have type JXMXfragmentsJXMXJ\,X\to M\,X, and bind takes morphisms of type JXMYfragmentsJXMYJ\,X\to M\,Y to morphisms of type MXMYfragmentsMXMYM\,X\to M\,Y. The functor M𝑀M must be expressible via these operations by Mf=(returnJf)fragmentsMf(returnJf)M\,f=({\operator@font return}\circ J\,f)^{*}. Other relative monad laws look the same as the monad laws of returnreturn{\operator@font return} and (_)fragments(_)(\_)^{*}. Monads are relative monads where J=IfragmentsJIJ=I. Due to the different types, the alternative representation via joinjoin{\operator@font join} is impossible for relative monads in general.

A monad morphism from M𝑀M to MfragmentsMM^{\prime} is a structure-preserving transformation between these monads, i.e., σ:MXMXfragmentsσ:MXMX\sigma:M\,X\to M^{\prime}\,X such that σreturn=returnfragmentsσreturnreturn\sigma\circ{\operator@font return}={\operator@font return} and σk=(σk)σfragmentsσk(σk)σ\sigma\circ k^{*}=(\sigma\circ k)^{*}\circ\sigma, where returnreturn{\operator@font return} and (_)fragments(_)(\_)^{*} in the left-hand sides belong to M𝑀M and those in the right-hand sides belong to MfragmentsMM^{\prime}. Analogously, one can define relative monad morphisms.

The term pointed functor is sometimes used for denoting functors F𝐹F equipped with a unit return:XFXfragmentsreturn:XFX{\operator@font return}:X\to F\,X (for any X𝑋X) but without monad bind. The unit is assumed to meet the naturality law returnf=FfreturnfragmentsreturnfFfreturn{\operator@font return}\circ f=F\,f\circ{\operator@font return}. The term dates back to at least Lenisa et al. (DBLP:journals/entcs/LenisaPW00). We prefer to call returnreturn{\operator@font return} of a pointed functor its point rather than unit, since calling something a unit normally assumes a certain relationship with another (binary) operation (like the unit laws relating unit and bind in the case of monads) which is missing in the general case of pointed functors. We will occasionally call the unit of a relative monad also point or relative point.

3. A Brief Introduction to MTL Classes

Monads as a framework suitable for embedding computational effects were discovered and advocated by Moggi (Moggi1990). The same work studied constructs in category theory that we now know as monad transformers. Using monad transformers in Haskell was proposed by Liang et al. (DBLP:conf/popl/LiangHJ95), Jones (DBLP:conf/afp/Jones95) and Hutton and Meijer (HuttonM1996). The Haskell MTL has been built upon ideas of those papers. It defines the exception, reader, writer, and state monad transformers as follows:


\pboxed\column

B@¿l¡@\column18@¿l¡@\column21@¿l¡@\column24@¿l¡@\column27@¿l¡@\column38@¿l¡@\columnE@¿l¡@ [B]newtypeExceptT\<[18] [18]e\<[21] [21]m\<[24] [24]a\<[27] [27]=ExceptT\<[38] [38](m (Eitherea))\<[E]
 [B]newtypeReaderT\<[18] [18]r\<[21] [21]m\<[24] [24]a\<[27] [27]=ReaderT\<[38] [38](rma)\<[E]
 [B]newtypeWriterT\<[18] [18]w\<[21] [21]m\<[24] [24]a\<[27] [27]=WriterT\<[38] [38](m (a,w))\<[E]
 [B]newtypeStateT\<[18] [18]s\<[21] [21]m\<[24] [24]a\<[27] [27]=StateT\<[38] [38](sm (a,s))\<[E]\endpboxed


(There are more transformers but we only study these four.) Every transformer assumes a type constructor as its second parameter m𝑚\mathit{m}; provided that it is a monad, application of the transformer produces a new monad. Substituting the identity monad for m𝑚\mathit{m}, we obtain the error, reader, writer, and state monads, respectively. Using the language of category theory, we can define these monads as Except(E,X)=E+XfragmentsExcept(E,X)EX{\operator@font Except}\,(E,X)=E+X, Reader(R,X)=RXfragmentsReader(R,X)RX{\operator@font Reader}\,(R,X)=R\to X, Writer(W,X)=X×WfragmentsWriter(W,X)XW{\operator@font Writer}\,(W,X)=X\times W, and State(S,X)=SX×SfragmentsState(S,X)SXS{\operator@font State}\,(S,X)=S\to X\times S. (Still we use the Haskell notation ABfragmentsABA\to B for function space which deviates from the notations of exponential objects used in category theory.)

Every transformer adds new effects to the monad while keeping the previously existing effects in force and available:

  • The exception monad transformer adds capability of dealing with errors, where errors are values of the type given as the first parameter of the transformer;

  • The state monad transformer enables one to use a hidden mutable state for computation, where states have type given as the first parameter of the transformer;

  • The reader monad transformer makes it possible to use hidden “environments” of the type given as the first parameter of the transformer;

  • The writer monad transformer introduces the ability of information logging throughout the computation, where the data items written into the log are of the type determined by the first parameter of the transformer.

We omit the details of defining the relevant operations and their propagation through chains of monad transformer applications; they are not needed for understanding the paper.

It is convenient to have every effect introduced by some monad transformer accessible via a fixed interface irrespectively of other monad transformers applied. For that reason, MTL defines type classes 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError}, 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader}, 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} and 𝑀𝑜𝑛𝑎𝑑𝑆𝑡𝑎𝑡𝑒𝑀𝑜𝑛𝑎𝑑𝑆𝑡𝑎𝑡𝑒\mathit{MonadState} (and others for effects not considered here). For instance, 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError} defines the interface of exception throwing and handling, 𝑀𝑜𝑛𝑎𝑑𝑆𝑡𝑎𝑡𝑒𝑀𝑜𝑛𝑎𝑑𝑆𝑡𝑎𝑡𝑒\mathit{MonadState} specifies the interface for stateful computation, etc. Each of the following sections 47 discusses one of these type classes, providing also the definition details.

4. Laws of Exception Handling

MTL defines the 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError} class along with methods for throwing and catching of exceptions as follows:


\pboxed\column

B@¿l¡@\column5@¿l¡@\column17@¿l¡@\columnE@¿l¡@ [B]class (Monadm)⇒MonadErroremmewhere\<[E]
 [B] \<[5] [5]throwError\<[17] [17]::ema\<[E]
 [B] \<[5] [5]catchError\<[17] [17]::ma→(ema)→ma\<[E]\endpboxed


Here e𝑒\mathit{e} denotes the type of exceptions; it is a parameter of the class but not of m𝑚\mathit{m}. Gibbons and Hinze (DBLP:conf/icfp/GibbonsH11) consider axioms of exception handling in a narrower setting that does not involve an exception type (it is equivalent to 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError} with e=()fragmentse()\mathit{e}\mathrel{=}()). Their axioms state that catch is associative, whereas failure (throwing the exception) is its unit and a left zero of >>fragments\mathbin{>\!\!\!>} as well. Both Malakhovski (DBLP:journals/corr/abs-1810-13430) and the author (DBLP:conf/ictac/Nestra19) assume a wider setting with the type e𝑒\mathit{e} being an additional parameter of the functor m𝑚\mathit{m}, replacing the latter with a bifunctor F𝐹F. The error throwing function has type EF(E,A)fragmentsEF(E,A)E\to F\,(E,A) and return obtains type AF(E,A)fragmentsAF(E,A)A\to F\,(E,A). The catch function in (DBLP:conf/ictac/Nestra19) has type (EF(E,A))F(E,A)F(E,A)fragments(EF(E,A))F(E,A)F(E,A)(E\to F\,(E^{\prime},A))\to F\,(E,A)\to F\,(E^{\prime},A) similarly to bind which has type (AF(E,A))F(E,A)F(E,A)fragments(AF(E,A))F(E,A)F(E,A)(A\to F\,(E,A^{\prime}))\to F\,(E,A)\to F\,(E,A^{\prime}); in (DBLP:journals/corr/abs-1810-13430), the order of arguments of these functions is reversed.

Following (DBLP:conf/ictac/Nestra19), we denote the bind and catch operations by (_)fragments(_)exclusive-or(\_){}^{\veebar} and (_)fragments(_)not-and(\_){}^{\barwedge}, respectively, and denote the error throwing function by throwthrow{\operator@font throw}. That work proposes the following axioms for bind, among which the first three are standard monad axioms, the fourth one is a generalization of the usual monad zero law by introducing an exception parameter, and the last one establishes that any mapping of exceptions by the bifunctor is a bind homomorphism:

kreturnfragmentskexclusive-orreturn\displaystyle k{}^{\veebar}\circ{\operator@font return} =kfragmentsk\displaystyle\;{}={}\;k
(returnf)fragments(returnf)exclusive-or\displaystyle({\operator@font return}\circ f){}^{\veebar} =F(id,f)fragmentsF(id,f)\displaystyle\;{}={}\;F\,({\operator@font id},f)
lkfragmentslexclusive-orkexclusive-or\displaystyle l{}^{\veebar}\circ k{}^{\veebar} =(lk)fragments(lexclusive-ork)exclusive-or\displaystyle\;{}={}\;(l{}^{\veebar}\circ k){}^{\veebar}
kthrowfragmentskexclusive-orthrow\displaystyle k{}^{\veebar}\circ{\operator@font throw} =throwfragmentsthrow\displaystyle\;{}={}\;{\operator@font throw}
F(h,id)kfragmentsF(h,id)kexclusive-or\displaystyle F\,(h,{\operator@font id})\circ k{}^{\veebar} =(F(h,id)k)F(h,id)fragments(F(h,id)k)exclusive-orF(h,id)\displaystyle\;{}={}\;(F\,(h,{\operator@font id})\circ k){}^{\veebar}\circ F\,(h,{\operator@font id})

For catch, the dual laws are proposed:

kthrowfragmentsknot-andthrow\displaystyle k{}^{\barwedge}\circ{\operator@font throw} =kfragmentsk\displaystyle\;{}={}\;k
(throwh)fragments(throwh)not-and\displaystyle({\operator@font throw}\circ h){}^{\barwedge} =F(h,id)fragmentsF(h,id)\displaystyle\;{}={}\;F\,(h,{\operator@font id})
lkfragmentslnot-andknot-and\displaystyle l{}^{\barwedge}\circ k{}^{\barwedge} =(lk)fragments(lnot-andk)not-and\displaystyle\;{}={}\;(l{}^{\barwedge}\circ k){}^{\barwedge}
kreturnfragmentsknot-andreturn\displaystyle k{}^{\barwedge}\circ{\operator@font return} =returnfragmentsreturn\displaystyle\;{}={}\;{\operator@font return}
F(id,f)kfragmentsF(id,f)knot-and\displaystyle F\,({\operator@font id},f)\circ k{}^{\barwedge} =(F(id,f)k)F(id,f)fragments(F(id,f)k)not-andF(id,f)\displaystyle\;{}={}\;(F\,({\operator@font id},f)\circ k){}^{\barwedge}\circ F\,({\operator@font id},f)

All but the last axiom of both blocks occur also in (DBLP:journals/corr/abs-1810-13430). All axioms introduced so far are meaningful also in the standard MTL setting. In addition, (DBLP:conf/ictac/Nestra19) considers the following law for interchanging bind and catch, where ρ=throwreturnfragmentsρthrowreturn\rho={\operator@font throw}\either{\operator@font return}:

kρfragmentskexclusive-orρnot-and\displaystyle k{}^{\veebar}\circ\rho{}^{\barwedge} =(throwk)(F(inl,id)k)fragments(throwk)not-and(F(inl,id)k)exclusive-or\displaystyle\;{}={}\;({\operator@font throw}\either k){}^{\barwedge}\circ(F\,({\operator@font inl},{\operator@font id})\circ k){}^{\veebar}

This law inherently exploits the two-parameter setting since ρfragmentsρnot-and\rho{}^{\barwedge} changes the exception type of the computation.

The following is established by (DBLP:conf/ictac/Nestra19), where propagation of throw and catch through applications of transformers are assumed to be defined similarly to MTL:

  • Any monad obtained by applying the error monad transformer to another monad (and considered as a bifunctor) satisfies all the given laws;

  • Applying the error, reader, writer, or state monad transformer preserves all the given laws.

The paper (DBLP:conf/ictac/Nestra19) defines the joint handle (_)\coAsteriskfragments(_)\coAsterisk(\_){}^{\coAsterisk} via (_)fragments(_)exclusive-or(\_){}^{\veebar} and (_)fragments(_)not-and(\_){}^{\barwedge} by k\coAsterisk=kρF(inrinl,inr)fragmentsk\coAsteriskkexclusive-orρnot-andF(inrinl,inr)k{}^{\coAsterisk}=k{}^{\veebar}\circ\rho{}^{\barwedge}\circ F\,({\operator@font inr}\circ{\operator@font inl},{\operator@font inr}) and finds an axiomatics for it that is equivalent to the set of 11 axioms described above. Namely, it observes that ρ:E+AF(E,A)fragmentsρ:EAF(E,A)\rho:E+A\to F\,(E,A) and (_)\coAsterisk:(E+AF(E,A))F(E,A)F(E,A)fragments(_)\coAsterisk:(EAF(E,A))F(E,A)F(E,A)(\_){}^{\coAsterisk}:(E+A\to F\,(E^{\prime},A^{\prime}))\to F\,(E,A)\to F\,(E^{\prime},A^{\prime}), the types coinciding with those of relative monad unit and bind where the sum bifunctor is in the role of the base functor J𝐽J. The axiomatics contains the relative monad laws k\coAsteriskρ=kfragmentsk\coAsteriskρkk{}^{\coAsterisk}\circ\rho=k, ρ\coAsterisk=idfragmentsρ\coAsteriskid\rho{}^{\coAsterisk}={\operator@font id}, and (ρ(h+f))\coAsterisk=F(h,f)fragments(ρ(hf))\coAsteriskF(h,f)(\rho\circ(h+f)){}^{\coAsterisk}=F(h,f); the remaining law, associativity l\coAsteriskk\coAsterisk=(l\coAsteriskk)\coAsteriskfragmentsl\coAsteriskk\coAsterisk(l\coAsteriskk)\coAsteriskl{}^{\coAsterisk}\circ k{}^{\coAsterisk}=(l{}^{\coAsterisk}\circ k){}^{\coAsterisk}, is not valid in general, wherefore it is replaced with three special cases which establish the desired equivalence. For details, please see (DBLP:conf/ictac/Nestra19).

We can classify all operations considered in (DBLP:conf/ictac/Nestra19), including those not discussed here, into three levels:

  1. (1)

    Point operations that create structured objects from pure values: throwthrow{\operator@font throw}, returnreturn{\operator@font return}, and the joint unit ρ𝜌\rho. (In (DBLP:conf/ictac/Nestra19), the joint unit is denoted by η𝜂\eta. We preferred ρ𝜌\rho for the sake of uniform notation throughout this paper.)

  2. (2)

    Mixmap ϕ:(E+AE+A)F(E,A)F(E,A)fragmentsϕ:(EAEA)F(E,A)F(E,A)\phi:(E+A\to E^{\prime}+A^{\prime})\to F\,(E,A)\to F\,(E^{\prime},A^{\prime}) and its special cases e.g. fuser:F(E+A,A)F(E,A)fragmentsfuser:F(EA,A)F(E,A){\operator@font fuser}:F\,(E+A,A)\to F\,(E,A) and fusel:F(E,E+A)F(E,A)fragmentsfusel:F(E,EA)F(E,A){\operator@font fusel}:F\,(E,E+A)\to F\,(E,A) given by equations fusel=ϕ(inlid)fragmentsfuselϕ(inlid){\operator@font fusel}=\phi({\operator@font inl}\either{\operator@font id}) and fuser=ϕ(idinr)fragmentsfuserϕ(idinr){\operator@font fuser}=\phi({\operator@font id}\either{\operator@font inr}). These functions change, without side effects, the output value returned or thrown by their argument computation, but are more general than standard 𝑓𝑚𝑎𝑝𝑓𝑚𝑎𝑝\mathit{fmap} and 𝑏𝑖𝑚𝑎𝑝𝑏𝑖𝑚𝑎𝑝\mathit{bimap} as they are able to “mix” the bifunctor arguments E𝐸E and A𝐴A. (For example, fuselfusel{\operator@font fusel} moves some errors from the right-hand argument to the left.) MTL defines no functions of the mixmap category with 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError} class constraint but in the framework of (DBLP:conf/ictac/Nestra19) they can be expressed in terms of existing functions; for instance, fuser=ρfragmentsfuserρnot-and{\operator@font fuser}=\rho{}^{\barwedge} and fusel=ρfragmentsfuselρexclusive-or{\operator@font fusel}=\rho{}^{\veebar}.

  3. (3)

    Handle functions. This level contains functions that execute effectful computations in sequence, i.e., bind, catch and the joint handle. This level subsumes the previous level as one can define mixmap in its general form in terms of the joint handle by ϕ(g)=(ρg)\coAsteriskfragmentsϕ(g)(ρg)\coAsterisk\phi(g)=(\rho\circ g){}^{\coAsterisk}.

5. Reader Monads Equationally

The class 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader} is designed for encoding computations in an implicit environment. Computations in an environment can be seen as stateful computations with the state being immutable. The class is defined in MTL as follows, where r𝑟\mathit{r} stands for the type of the environment:


\pboxed\column

B@¿l¡@\column5@¿l¡@\column15@¿c¡@\column15E@l@\column19@¿l¡@\column23@¿l¡@\columnE@¿l¡@ [B]classMonadmMonadReaderrmmrwhere\<[E]
 [B] \<[5] [5]ask\<[15] [15]::\<[15E] [19]mr\<[E]
 [B] \<[5] [5]ask\<[15] [15]=\<[15E] [19]readerid\<[E]
 [B] \<[5] [5]local\<[15] [15]::\<[15E] [19](rr)→mama\<[E]
 [B] \<[5] [5]reader\<[15] [15]::\<[15E] [19](ra)→ma\<[E]
 [B] \<[5] [5]readerf\<[15] [15]=\<[15E] [19]do\<[23] [23]{ rask;return (fr); }\<[E]\endpboxed


The documentation of the source code specifies that the method 𝑎𝑠𝑘𝑎𝑠𝑘\mathit{ask} should return the environment of the computation. We assume that 𝑎𝑠𝑘𝑎𝑠𝑘\mathit{ask} has no side effect (though the documentation leaves it unspecified). The method 𝑟𝑒𝑎𝑑𝑒𝑟𝑟𝑒𝑎𝑑𝑒𝑟\mathit{reader} generalizes it by allowing to apply an arbitrary function to the environment. Up to isomorphism, this method embeds the reader monad (defined in Sect. 3) into the monad m𝑚\mathit{m}. This method is analogous to ρ𝜌\rho of Sect. 4 that similarly embeds the exception monad into m𝑚\mathit{m}. In the hierarchy described in Sect. 4, both 𝑎𝑠𝑘𝑎𝑠𝑘\mathit{ask} and 𝑟𝑒𝑎𝑑𝑒𝑟𝑟𝑒𝑎𝑑𝑒𝑟\mathit{reader} belong to the first level as point functions. The method 𝑙𝑜𝑐𝑎𝑙𝑙𝑜𝑐𝑎𝑙\mathit{local} sets up a modified environment for a local computation. It is a functor application by nature but the Haskell type does not reflect this because the environment type is not a parameter of m𝑚\mathit{m}.

We abandon some Haskell function names in favour of mathematical notation. Similarly to what we saw in the case of exceptions, we here treat the environment type as an extra (first) parameter of the monad and denote the obtained bifunctor by F𝐹F. Hence 𝑙𝑜𝑐𝑎𝑙hfragmentslocalh\mathit{local}\,h is written as F(h,id)fragmentsF(h,id)F\,(h,{\operator@font id}). Note that F𝐹F is contravariant in its first argument, i.e., if h:RRfragmentsh:RRh:R^{\prime}\to R then F(h,id):F(R,X)F(R,X)fragmentsF(h,id):F(R,X)F(R,X)F\,(h,{\operator@font id}):F\,(R,X)\to F\,(R^{\prime},X). The method 𝑟𝑒𝑎𝑑𝑒𝑟𝑟𝑒𝑎𝑑𝑒𝑟\mathit{reader} is denoted by ρ:(RX)F(R,X)fragmentsρ:(RX)F(R,X)\rho:(R\to X)\to F\,(R,X). The arrow that constructs function spaces (like in RXfragmentsRXR\to X) can be made a bifunctor by defining, for any h:RRfragmentsh:RRh:R^{\prime}\to R and f:XXfragmentsf:XXf:X\to X^{\prime}, a new function hf:(RX)(RX)fragmentshf:(RX)(RX)h\to f:(R\to X)\to(R^{\prime}\to X^{\prime}) by the equation (hf)g=fghfragments(hf)gfgh(h\to f)\,g=f\circ g\circ h. We will use this notation occasionally in this section.

In Subsection 5.1, we propose an axiomatization of computations in environment which directly implies its every model being isomorphic to a monad obtained by an application of the reader monad transformer. It turns out that the exception, reader, writer and state monad transformers preserve the axioms. This axiomatics uses ρ𝜌\rho as a primitive; in Subsect. 5.2, we consider an equivalent axiomatics that uses askask{\operator@font ask} as a primitive and defines ρ𝜌\rho in terms of it.

5.1. Reduction to Reader Transformer Applications

Recall that we assume computations in environment being described by a bifunctor F𝐹F whose first parameter is the environment type and second parameter is the type of the return value. The functor laws are F(id,id)=idfragmentsF(id,id)idF\,({\operator@font id},{\operator@font id})={\operator@font id} and F(hh,ff)=F(h,f)F(h,f)fragmentsF(hh,ff)F(h,f)F(h,f)F\,(h\circ h^{\prime},f^{\prime}\circ f)=F\,(h^{\prime},f^{\prime})\circ F\,(h,f); note the change in the order of the composed morphisms in the first argument due to contravariance. As in the case of exceptions, denote the monad unit and bind by returnreturn{\operator@font return} and (_)fragments(_)exclusive-or(\_){}^{\veebar}, respectively; their types here are return:XF(R,X)fragmentsreturn:XF(R,X){\operator@font return}:X\to F\,(R,X) and (_):(XF(R,X))F(R,X)F(R,X)fragments(_)exclusive-or:(XF(R,X))F(R,X)F(R,X)(\_){}^{\veebar}:(X\to F\,(R,X^{\prime}))\to F\,(R,X)\to F\,(R,X^{\prime}).

Developing an axiomatics that would imply its models being isomorphic to reader transformer applications requires introducing operations that have no counterpart in Haskell MTL. Before doing it, consider the laws to be required that are expressible in terms of standard operations. Firstly, changing the environment by F(h,id)fragmentsF(h,id)F\,(h,{\operator@font id}) being a monad morphism:

(Bifun-UnitHom) F(h,id)returnfragmentsF(h,id)return\displaystyle F\,(h,{\operator@font id})\circ{\operator@font return} =returnfragmentsreturn\displaystyle\;{}={}\;{\operator@font return}
(Bifun-BndHom) F(h,id)kfragmentsF(h,id)kexclusive-or\displaystyle F\,(h,{\operator@font id})\circ k{}^{\veebar} =(F(h,id)k)F(h,id)fragments(F(h,id)k)exclusive-orF(h,id)\displaystyle\;{}={}\;(F\,(h,{\operator@font id})\circ k){}^{\veebar}\circ F\,(h,{\operator@font id})

Next, ρ𝜌\rho being a monad morphism from the underlying reader monad R_fragmentsR_R\to\_ to the monad F(R,_)fragmentsF(R,_)F\,(R,\_):

(Rdr-UnitHom) ρconstfragmentsρconst\displaystyle\rho\circ{\operator@font const} =returnfragmentsreturn\displaystyle\;{}={}\;{\operator@font return}
(Rdr-BndHom) ρkfragmentsρk\displaystyle\rho\circ k^{*} =(ρk)ρfragments(ρk)exclusive-orρ\displaystyle\;{}={}\;(\rho\circ k){}^{\veebar}\circ\rho

Here, (_)fragments(_)(\_)^{*} denotes the bind operation of the underlying reader monad; note that constconst{\operator@font const} is its unit. And lastly, ρ𝜌\rho being a natural transformation between the power bifunctor and F𝐹F:

(Rdr-Nat) ρ(hf)fragmentsρ(hf)\displaystyle\rho\circ(h\to f) =F(h,f)ρfragmentsF(h,f)ρ\displaystyle\;{}={}\;F\,(h,f)\circ\rho

Although valid in all monads considered in this paper, these axioms are not as powerful as we could do by widening our point of view. The underlying assumption of our approach is that types of the form F(R,X)fragmentsF(R,X)F\,(R,X) encode, in some way, environment-dependent monadic computations. The dependency does not have to occur in the form of a function whose argument type is R𝑅R, because applying, for instance, the state monad transformer with state type S𝑆S to a member of 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader} with the environment type R𝑅R produces functions with argument type S𝑆S (i.e., not R𝑅R) inheriting the dependency on R𝑅R from the member of 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader}. Therefore, we introduce functions applyapply{\operator@font apply} and abstrabstr{\operator@font abstr} establishing an isomorphism between types F(R,X)fragmentsF(R,X)F\,(R,X) and RMXfragmentsRMXR\to M\,X for a monad M𝑀M. More precisely:

applyapply\displaystyle{\operator@font apply} :F(R,X)RMXfragments:F(R,X)RMX\displaystyle\;{}:{}\;F\,(R,X)\to R\to M\,X
abstrabstr\displaystyle{\operator@font abstr} :(RMX)F(R,X)fragments:(RMX)F(R,X)\displaystyle\;{}:{}\;(R\to M\,X)\to F\,(R,X)

So a computation of the form applytrfragmentsapplytr\mathop{{\operator@font apply}}\nolimits t\,r fixes the environment of the environment-dependent computation t𝑡t to be r𝑟r, which intuitively is an application of a hidden function, and abstrffragmentsabstrf\mathop{{\operator@font abstr}}\nolimits f “abstracts” the parameter of its argument function f𝑓f by hiding it into the functor computation.

Table 1 presents precise definitions of the exception, reader, writer and state monad transformers (denoted by EfragmentsE𝐸\mathcal{E}_{E}, QfragmentsR𝑄\mathcal{R}_{Q}, 𝒲WfragmentsW𝑊\mathcal{W}_{W} and 𝒮SfragmentsS𝑆\mathcal{S}_{S}, respectively) along with the corresponding bifunctor transformers (which are denoted similarly) and specifies propagation of ρ𝜌\rho, applyapply{\operator@font apply} and abstrabstr{\operator@font abstr} through the transformers; we omit definitions of morphism mappings of the functors and monad operations as they are standard. (In the defining equations for ρ𝜌\rho, applyapply{\operator@font apply} and abstrabstr{\operator@font abstr}, the occurrences of these operations in the l.h.s. are those of the bifunctor constructed by the transformer while the occurrences in the r.h.s. belong to the original bifunctor F𝐹F.) By sequential application of these transformers in all possible orders, we achieve a set of infinitely many structures each either having F𝐹F, M𝑀M and the related operations defined in terms of those of a simpler member structure of this set or being a base case, for which we can take F(R,X)=RMXfragmentsF(R,X)RMXF\,(R,X)=R\to M\,X with ρ=idreturnfragmentsρidreturn\rho={\operator@font id}\to{\operator@font return} and both applyapply{\operator@font apply} and abstrabstr{\operator@font abstr} defined as identities. Note that propagation of ρ𝜌\rho is for all transformers defined via composing from the left with the lift operation of the particular transformer; this matches the definition of 𝑟𝑒𝑎𝑑𝑒𝑟𝑟𝑒𝑎𝑑𝑒𝑟\mathit{reader} in MTL in the case of exception, writer, and state monad transformer.

Table 1. Definitions of functions ρ𝜌\rho, applyapply{\operator@font apply} and abstrabstr{\operator@font abstr} for different monad transformers.
Exception transformer:EMX=M(E+X)EF(R,X)=F(R,E+X)ρ=F(id,inr)ρapplytr=applytrabstrf=abstrfReader transformer:QMX=QMXQF(R,X)=QF(R,X)ρ=constρapplytr=qapply(tq)rabstrf=qabstr(rfrq)Writer transformer:𝒲WMX=M(X×W)𝒲WF(R,X)=F(R,X×W)ρ=F(id,idconst1)ρapplytr=applytrabstrf=abstrfState transformer:𝒮SMX=SM(X×S)𝒮SF(R,X)=SF(R,X×S)ρ=(tsF(id,idconsts)t)ρapplytr=sapply(ts)rabstrf=sabstr(rfrs)fragmentsException transformer:fragmentsE𝐸MXfragmentsM(EX)fragmentsE𝐸F(R,X)fragmentsF(R,EX)𝜌fragmentsF(id,inr)ρfragmentsapplytrfragmentsapplytrfragmentsabstrffragmentsabstrfReader transformer:fragmentsR𝑄MXfragmentsQMXfragmentsR𝑄F(R,X)fragmentsQF(R,X)𝜌fragmentsconstρfragmentsapplytrfragmentsqapply(tq)rfragmentsabstrffragmentsqabstr(rfrq)Writer transformer:fragmentsW𝑊MXfragmentsM(XW)fragmentsW𝑊F(R,X)fragmentsF(R,XW)𝜌fragmentsF(id,idconst1)ρfragmentsapplytrfragmentsapplytrfragmentsabstrffragmentsabstrfmissing-subexpressionState transformer:fragmentsS𝑆MXfragmentsSM(XS)fragmentsS𝑆F(R,X)fragmentsSF(R,XS)𝜌fragments(tsF(id,idconsts)t)ρfragmentsapplytrfragmentssapply(ts)rfragmentsabstrffragmentssabstr(rfrs)\begin{array}[]{c}\begin{array}[]{rcl}\lx@intercol\mbox{Exception transformer:}\hfil\lx@intercol\\ \mathcal{E}_{E}M\,X&=&M\,(E+X)\\ \mathcal{E}_{E}F\,(R,X)&=&F\,(R,E+X)\\ \rho&=&F\,({\operator@font id},{\operator@font inr})\circ\rho\\ \mathop{{\operator@font apply}}\nolimits t\,r&=&\mathop{{\operator@font apply}}\nolimits t\,r\\ \mathop{{\operator@font abstr}}\nolimits f&=&\mathop{{\operator@font abstr}}\nolimits f\end{array}\;\;\;\begin{array}[]{rcl}\lx@intercol\mbox{Reader transformer:}\hfil\lx@intercol\\ \mathcal{R}_{Q}M\,X&=&Q\to M\,X\\ \mathcal{R}_{Q}F\,(R,X)&=&Q\to F\,(R,X)\\ \rho&=&{\operator@font const}\circ\rho\\ \mathop{{\operator@font apply}}\nolimits t\,r&=&\qlam q\centerdot\mathop{{\operator@font apply}}\nolimits(t\,q)\,r\\ \mathop{{\operator@font abstr}}\nolimits f&=&\qlam q\centerdot\mathop{{\operator@font abstr}}\nolimits(\qlam r\centerdot f\,r\,q)\end{array}\;\begin{array}[]{rcl}\lx@intercol\mbox{Writer transformer:}\hfil\lx@intercol\\ \mathcal{W}_{W}M\,X&=&M\,(X\times W)\\ \mathcal{W}_{W}F\,(R,X)&=&F\,(R,X\times W)\\ \rho&=&F\,({\operator@font id},{\operator@font id}\both\mathop{{\operator@font const}}\nolimits\mbox{{1}})\circ\rho\\ \mathop{{\operator@font apply}}\nolimits t\,r&=&\mathop{{\operator@font apply}}\nolimits t\,r\\ \mathop{{\operator@font abstr}}\nolimits f&=&\mathop{{\operator@font abstr}}\nolimits f\end{array}\\ \\ \begin{array}[]{rcl}\lx@intercol\mbox{State transformer:}\hfil\lx@intercol\\ \mathcal{S}_{S}M\,X&=&S\to M\,(X\times S)\\ \mathcal{S}_{S}F\,(R,X)&=&S\to F\,(R,X\times S)\\ \rho&=&(\qlam ts\centerdot F\,({\operator@font id},{\operator@font id}\both\mathop{{\operator@font const}}\nolimits s)\,t)\circ\rho\\ \mathop{{\operator@font apply}}\nolimits t\,r&=&\qlam s\centerdot\mathop{{\operator@font apply}}\nolimits(t\,s)\,r\\ \mathop{{\operator@font abstr}}\nolimits f&=&\qlam s\centerdot\mathop{{\operator@font abstr}}\nolimits(\qlam r\centerdot f\,r\,s)\end{array}\\ \hline\cr\end{array}

Denote the unit and bind of M𝑀M by returnreturn{\operator@font return} and (_)fragments(_)exclusive-or(\_){}^{\veebar} like those of F(R,_)fragmentsF(R,_)F\,(R,\_). We specify applyapply{\operator@font apply} equationally as a function translating the operations of F𝐹F to operations of M𝑀M:

(App-Nat) applyF(h,f)fragmentsapplyF(h,f)\displaystyle{\operator@font apply}\circ F\,(h,f) =(hMf)applyfragments(hMf)apply\displaystyle\;{}={}\;(h\to M\,f)\circ{\operator@font apply}
(App-UnitHom) applyreturnfragmentsapplyreturn\displaystyle{\operator@font apply}\circ{\operator@font return} =constreturnfragmentsconstreturn\displaystyle\;{}={}\;{\operator@font const}\circ{\operator@font return}
(App-BndHom) applykfragmentsapplykexclusive-or\displaystyle{\operator@font apply}\circ k{}^{\veebar} =(applyk)applyfragments(applyk)fragmentsexclusive-orapply\displaystyle\;{}={}\;({\operator@font apply}\circ k){}^{\veebar{}^{{}^{-}}}\circ{\operator@font apply}
(App-Rdr) applyρfragmentsapplyρ\displaystyle{\operator@font apply}\circ\rho =idreturnfragmentsidreturn\displaystyle\;{}={}\;{\operator@font id}\to{\operator@font return}

Here, (_)fragments(_)fragmentsexclusive-or(\_){}^{\veebar{}^{{}^{-}}} in the r.h.s. of App-BndHom denotes the monad bind of M𝑀M lifted to functions. Note that constreturnfragmentsconstreturn{\operator@font const}\circ{\operator@font return} in App-UnitHom similarly lifts returnreturn{\operator@font return} to functions. We also assume that applyapply{\operator@font apply} and abstrabstr{\operator@font abstr} are inverses of each other:

(App-Abs) applyabstrfragmentsapplyabstr\displaystyle{\operator@font apply}\circ{\operator@font abstr} =idfragmentsid\displaystyle\;{}={}\;{\operator@font id}
(Abs-App) abstrapplyfragmentsabstrapply\displaystyle{\operator@font abstr}\circ{\operator@font apply} =idfragmentsid\displaystyle\;{}={}\;{\operator@font id}

As a consequence, proving properties of F𝐹F and ρ𝜌\rho are reduced to proving properties of monad M𝑀M. The following theorems hold in 𝑺𝒆𝒕fragmentsSet\boldsymbol{Set}:

Theorem 5.1.

Let M𝑀M be a monad. Let F𝐹F be a type-preserving, contravariant in its first argument, binary mapping of objects and morphisms. Let ρ𝜌\rho, applyapply{\operator@font apply}, abstrabstr{\operator@font abstr} have their right types and meet axioms App-Nat, App-UnitHom, App-BndHom, App-Rdr, App-Abs and Abs-App. Then F𝐹F meets the functor laws, its left section for every type R𝑅R is a monad w.r.t. returnreturn{\operator@font return} and (_)fragments(_)exclusive-or(\_){}^{\veebar}, and the equations Bifun-UnitHom, Bifun-BndHom, Rdr-UnitHom, Rdr-BndHom and Rdr-Nat are all valid.

Theorem 5.2.

Let M𝑀M be a monad. Then:

  • The bifunctor obtained by applying the reader monad transformer with an environment type R𝑅R to M𝑀M, with applyapply{\operator@font apply} and abstrabstr{\operator@font abstr} defined as identities and other operations defined like in the Haskell MTL, satisfies the axioms App-Nat, App-UnitHom, App-BndHom, App-Rdr, App-Abs and Abs-App;

  • Applying the exception, reader, writer and state bifunctor (and monad) transformers preserve these axioms.

Proofs are straightforward.

5.2. Axioms of 𝑎𝑠𝑘𝑎𝑠𝑘\mathit{ask}

The definition of class 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader} provides mutual definitions of 𝑟𝑒𝑎𝑑𝑒𝑟𝑟𝑒𝑎𝑑𝑒𝑟\mathit{reader} and 𝑎𝑠𝑘𝑎𝑠𝑘\mathit{ask}, looking in our language as follows:

(Ask-Rdr) askask\displaystyle{\operator@font ask} =ρ(id)fragmentsρ(id)\displaystyle\;{}={}\;\rho({\operator@font id})
(Rdr-Ask) ρ(f)fragmentsρ(f)\displaystyle\rho(f) =F(id,f)askfragmentsF(id,f)ask\displaystyle\;{}={}\;F\,({\operator@font id},f)\,{\operator@font ask}

In order to axiomatize askask{\operator@font ask} instead of ρ𝜌\rho, we replace App-Rdr with

(App-Ask) applyaskfragmentsapplyask\displaystyle\mathop{{\operator@font apply}}\nolimits{\operator@font ask} =returnfragmentsreturn\displaystyle\;{}={}\;{\operator@font return}

That is, asking of the environment as a computation of type F(R,R)fragmentsF(R,R)F\,(R,R), when presented as a function of type RMRfragmentsRMRR\to M\,R, equals the monad unit of M𝑀M that immediately returns the argument environment.

This gives an equivalent axiomatics indeed, as established by the following theorem:

Theorem 5.3.

Let M𝑀M be a monad. Let F𝐹F be a type-preserving, contravariant in its first argument, binary mapping of objects and morphisms. Let ρ𝜌\rho, applyapply{\operator@font apply}, abstrabstr{\operator@font abstr} have their right types and meet axioms App-Nat, App-UnitHom, App-BndHom, App-Abs and Abs-App. Then the set of equations {App-Rdr,Ask-Rdr}fragments{App-Rdr,Ask-Rdr}\left\{\ref{reader:apply-rdr},\ref{reader:ask-rdr}\right\} is equivalent to the set of equations {App-Ask,Rdr-Ask}fragments{App-Ask,Rdr-Ask}\left\{\ref{reader:apply-ask},\ref{reader:rdr-ask}\right\}.

Proof.

Straightforward but we present it fully for illustrating equational reasoning in our axiomatics. If we assume App-Rdr, the premises of Theorem 5.1 are fully met which allows us to use Rdr-Nat in the proof of Rdr-Ask. In the proof of Ask-Rdr, we can use functor laws since their proof does not need App-Rdr.

  • {App-Rdr,Ask-Rdr}{App-Ask,Rdr-Ask}fragments{App-Rdr,Ask-Rdr}{App-Ask,Rdr-Ask}\left\{\ref{reader:apply-rdr},\ref{reader:ask-rdr}\right\}\Longrightarrow\left\{\ref{reader:apply-ask},\ref{reader:rdr-ask}\right\}:

    App-Ask:

    applyaskfragmentsapplyask\displaystyle\mathop{{\operator@font apply}}\nolimits{\operator@font ask}
    =fragments\displaystyle\;{}={}\; Ask-RdrfragmentsAsk-Rdr\displaystyle\Lbag\mbox{\ref{reader:ask-rdr}}\Rbag
    apply(ρ(id))fragmentsapply(ρ(id))\displaystyle\mathop{{\operator@font apply}}\nolimits(\rho({\operator@font id}))
    =fragments\displaystyle\;{}={}\; App-RdrfragmentsApp-Rdr\displaystyle\Lbag\mbox{\ref{reader:apply-rdr}}\Rbag
    (idreturn)idfragments(idreturn)id\displaystyle({\operator@font id}\to{\operator@font return})\,{\operator@font id}
    =fragments\displaystyle\;{}={}\; power, identityfragmentspower, identity\displaystyle\Lbag\mbox{power, identity}\Rbag
    returnreturn\displaystyle{\operator@font return}

    Rdr-Ask:

    F(id,f)askfragmentsF(id,f)ask\displaystyle F\,({\operator@font id},f)\,{\operator@font ask}
    =fragments\displaystyle\;{}={}\; Ask-RdrfragmentsAsk-Rdr\displaystyle\Lbag\mbox{\ref{reader:ask-rdr}}\Rbag
    F(id,f)(ρ(id))fragmentsF(id,f)(ρ(id))\displaystyle F\,({\operator@font id},f)\,(\rho({\operator@font id}))
    =fragments\displaystyle\;{}={}\; Rdr-NatfragmentsRdr-Nat\displaystyle\Lbag\mbox{\ref{reader:rdr-nat}}\Rbag
    ρ((idf)id)fragmentsρ((idf)id)\displaystyle\rho(({\operator@font id}\to f)\,{\operator@font id})
    =fragments\displaystyle\;{}={}\; power, identityfragmentspower, identity\displaystyle\Lbag\mbox{power, identity}\Rbag
    ρ(f)fragmentsρ(f)\displaystyle\rho(f)
  • {App-Ask,Rdr-Ask}{App-Rdr,Ask-Rdr}fragments{App-Ask,Rdr-Ask}{App-Rdr,Ask-Rdr}\left\{\ref{reader:apply-ask},\ref{reader:rdr-ask}\right\}\Longrightarrow\left\{\ref{reader:apply-rdr},\ref{reader:ask-rdr}\right\}:

    App-Rdr:

    apply(ρ(f))fragmentsapply(ρ(f))\displaystyle\mathop{{\operator@font apply}}\nolimits(\rho(f))
    =fragments\displaystyle\;{}={}\; Rdr-AskfragmentsRdr-Ask\displaystyle\Lbag\mbox{\ref{reader:rdr-ask}}\Rbag
    apply(F(id,f)ask)fragmentsapply(F(id,f)ask)\displaystyle\mathop{{\operator@font apply}}\nolimits(F\,({\operator@font id},f)\,{\operator@font ask})
    =fragments\displaystyle\;{}={}\; App-NatfragmentsApp-Nat\displaystyle\Lbag\mbox{\ref{reader:apply-nat}}\Rbag
    (idMf)(applyask)fragments(idMf)(applyask)\displaystyle({\operator@font id}\!\!\to\!\!M\,f)\,(\mathop{{\operator@font apply}}\nolimits{\operator@font ask})
    =fragments\displaystyle\;{}={}\; App-AskfragmentsApp-Ask\displaystyle\Lbag\mbox{\ref{reader:apply-ask}}\Rbag
    (idMf)returnfragments(idMf)return\displaystyle({\operator@font id}\!\!\to\!\!M\,f)\,{\operator@font return}
    =fragments\displaystyle\;{}={}\; power, identityfragmentspower, identity\displaystyle\Lbag\mbox{power, identity}\Rbag
    MfreturnfragmentsMfreturn\displaystyle M\,f\circ{\operator@font return}
    =fragments\displaystyle\;{}={}\; naturalityfragmentsnaturality\displaystyle\Lbag\mbox{naturality}\Rbag
    returnffragmentsreturnf\displaystyle{\operator@font return}\circ f
    =fragments\displaystyle\;{}={}\; power, identityfragmentspower, identity\displaystyle\Lbag\mbox{power, identity}\Rbag
    (idreturn)ffragments(idreturn)f\displaystyle({\operator@font id}\to{\operator@font return})\,f

    Ask-Rdr:

    ρ(id)fragmentsρ(id)\displaystyle\rho({\operator@font id})
    =fragments\displaystyle\;{}={}\; Rdr-AskfragmentsRdr-Ask\displaystyle\Lbag\mbox{\ref{reader:rdr-ask}}\Rbag
    F(id,id)askfragmentsF(id,id)ask\displaystyle F\,({\operator@font id},{\operator@font id})\,{\operator@font ask}
    =fragments\displaystyle\;{}={}\; functor, identityfragmentsfunctor, identity\displaystyle\Lbag\mbox{functor, identity}\Rbag
    askask\displaystyle{\operator@font ask}

6. An Abstract View and its Application to 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter}

The class 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} is defined in MTL as follows:


\pboxed\column

B@¿l¡@\column5@¿l¡@\column13@¿l¡@\column23@¿l¡@\column28@¿c¡@\column28E@l@\column32@¿l¡@\columnE@¿l¡@ [B]class (Monoidw,Monadm)\<[28] [28]⇒\<[28E] [32]MonadWriterwm\<[E]
 [28]∣\<[28E] [32]mwwhere\<[E]
 [B] \<[5] [5]writer\<[13] [13]::(a,w)→ma\<[E]
 [B] \<[5] [5]tell\<[13] [13]::wm ()\<[E]
 [B] \<[5] [5]listen\<[13] [13]::mam (a,w)\<[E]
 [B] \<[5] [5]pass\<[13] [13]::m (a,ww)→ma\<[E]
 [B] \<[5] [5]writer\<[13] [13]∼(a,w)\<[23] [23]=do { tellw;returna; }\<[E]
 [B] \<[5] [5]tell\<[13] [13]w\<[23] [23]=writer ((),w)\<[E]\endpboxed


The method 𝑤𝑟𝑖𝑡𝑒𝑟𝑤𝑟𝑖𝑡𝑒𝑟\mathit{writer}, similarly to the method 𝑟𝑒𝑎𝑑𝑒𝑟𝑟𝑒𝑎𝑑𝑒𝑟\mathit{reader} in the class 𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑅𝑒𝑎𝑑𝑒𝑟\mathit{MonadReader}, embeds the writer monad into the monad m𝑚\mathit{m}. The method 𝑡𝑒𝑙𝑙𝑡𝑒𝑙𝑙\mathit{tell} logs the value given as argument and immediately returns the value ()fragments()(). It is a special case of 𝑤𝑟𝑖𝑡𝑒𝑟𝑤𝑟𝑖𝑡𝑒𝑟\mathit{writer}. Both belong to the first level in the hierarchy of Sect. 4.

The method 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} applies to a monadic computation and copies the whole log of this computation into its return value. The method 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass} applies to a monadic computation, the return value of which contains a function, and modifies the log of this computation by applying this function. Note that both 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} and 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass} modify a monadic computation in a way that can be encoded as a transformation of values of the writer monad, i.e., in the form of a function of type X×WX×WfragmentsXWXWX\times W\to X^{\prime}\times W: for 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen}, the corresponding function is (a,w)((a,w),w)fragments(a,w)((a,w),w)\qlam(a,w)\centerdot((a,w),w), and for 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass}, the function is ((a,f),w)(a,fw)fragments((a,f),w)(a,fw)\qlam((a,f),w)\centerdot(a,f\,w). According to Sect. 4, these methods are mixmaps and belong to the second level of the method hierarchy. If the class 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} contained a general method 𝑚𝑖𝑥𝑚𝑎𝑝::((a,w)(a,w))mamafragmentsmixmapfragments::((a,w)(a,w))mama\mathit{mixmap}\mathbin{::}((\mathit{a},\mathit{w})\to(\mathit{a^{\prime}},\mathit{w}))\to\mathit{m}\;\mathit{a}\to\mathit{m}\;\mathit{a^{\prime}}, we could define 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} and 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass} as


\pboxed\column

B@¿l¡@\column9@¿l¡@\columnE@¿l¡@ [B]listen\<[9] [9]=mixmap (λ(a,w)→((a,w),w))\<[E]
 [B]pass\<[9] [9]=mixmap (λ((a,f),w)→(a,fw))\<[E]\endpboxed


On the other hand, 𝑚𝑖𝑥𝑚𝑎𝑝𝑚𝑖𝑥𝑚𝑎𝑝\mathit{mixmap} can be defined in terms of 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} and 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass} by


\pboxed\column

B@¿l¡@\columnE@¿l¡@ [B]mixmapg=passfmap (bimapidconstg)∘listen\<[E]\endpboxed


Unlike in the case of exceptions and environments, we do not consider the monoid parameter of the class as an extra parameter of the monad. Keeping the monoid fixed enables us to derive the structure of the 𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑\mathit{WriterMonad} class methods as some kind of reflection of the structure of the underlying writer monad. This is not to say that generalizing the approach by letting the monoid vary would be pointless. In the rest of this section, we denote the monad under consideration by M𝑀M but also use the bifunctor notation occasionally in Subsections 6.2 and 6.4 (with fixed monoid).

6.1. Pointed Functors with Mixmap

Analogously to the case of exceptions, denote the relative point and mixmap by ρ𝜌\rho and ϕitalic-ϕ\phi, respectively. The following set of equations is valid for all monads of the class 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} that have been constructed by sequential application of the exception, reader, writer and state monad transformers:

(RPoint-RNat) ρffragmentsρf\displaystyle\rho\circ f =ϕ(f)ρfragmentsϕ(f)ρ\displaystyle\;{}={}\;\phi(f)\circ\rho
(Mixmap-Id) ϕ(id)fragmentsϕ(id)\displaystyle\phi({\operator@font id}) =idfragmentsid\displaystyle\;{}={}\;{\operator@font id}
(Mixmap-Comp) ϕ(gf)fragmentsϕ(gf)\displaystyle\phi(g\circ f) =ϕ(g)ϕ(f)fragmentsϕ(g)ϕ(f)\displaystyle\;{}={}\;\phi(g)\circ\phi(f)

The first equation is a “relative naturality” law that uses mixmap as one of the two functors that ρ𝜌\rho is working between (the other one is identity). The other two laws establish preservation of identity and composition. The last one is particularly interesting because, as shown in (DBLP:conf/ictac/Nestra19), it does not hold in the axiomatics of exceptions we saw in Sect. 4. In this sense, 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} behaves more nicely than 𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟𝑀𝑜𝑛𝑎𝑑𝐸𝑟𝑟𝑜𝑟\mathit{MonadError}.

For finding properties of 𝑡𝑒𝑙𝑙𝑡𝑒𝑙𝑙\mathit{tell}, 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} and 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass}, one can rely on the mixmap laws and the previously seen definitions of these methods in terms of mixmap. We will not search for an equivalent axiomatics using these methods as primitives but we define two simpler functions and find an equivalent axiomatics for them. To this end, note that 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} and 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass} serve dual purposes in the sense that 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} copies the log into the return value while 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass} moves information from the return value to the log. Instead of 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen} and 𝑝𝑎𝑠𝑠𝑝𝑎𝑠𝑠\mathit{pass}, we consider shift:MXM(X×W)fragmentsshift:MXM(XW){\operator@font shift}:M\,X\to M\,(X\times W) and fuse:M(X×W)MXfragmentsfuse:M(XW)MX{\operator@font fuse}:M\,(X\times W)\to M\,X, defined by equations shift=ϕ((a,w)((a,w),1))fragmentsshiftϕ((a,w)((a,w),1)){\operator@font shift}=\phi(\qlam(a,w)\centerdot((a,w),\mbox{{1}})) and fuse=ϕ(((a,w),w)(a,ww))fragmentsfuseϕ(((a,w),w)(a,ww)){\operator@font fuse}=\phi(\qlam((a,w^{\prime}),w)\centerdot(a,w\cdot w^{\prime})), that achieve the same aims in a cleaner way. The function shiftshift{\operator@font shift} copies the log into the return value but, unlike 𝑙𝑖𝑠𝑡𝑒𝑛𝑙𝑖𝑠𝑡𝑒𝑛\mathit{listen}, replaces the original with the monoid unit. The function fusefuse{\operator@font fuse} uses the monoid multiplication to join a monoid element in the return value with the current log. In terms of shiftshift{\operator@font shift} and fusefuse{\operator@font fuse}, the general mixmap can be expressed as

(Mixmap-FuseShift) ϕ(g)fragmentsϕ(g)\displaystyle\phi(g) =fuseMgshiftfragmentsfuseMgshift\displaystyle\;{}={}\;{\operator@font fuse}\circ M\,g\circ{\operator@font shift}

Note that p(p,1)fragmentsp(p,1)\qlam p\centerdot(p,\mbox{{1}}) and ((a,w),w)(a,ww)fragments((a,w),w)(a,ww)\qlam((a,w^{\prime}),w)\centerdot(a,w\cdot w^{\prime}) are the unit and join, respectively, of the writer monad. Denoting the unit and join by η𝜂\eta and μ𝜇\mu, respectively, we can abstract from the underlying monad and specify shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} by

(Shift-Mixmap) shiftshift\displaystyle{\operator@font shift} =ϕ(η)fragmentsϕ(η)\displaystyle\;{}={}\;\phi(\eta)
(Fuse-Mixmap) fusefuse\displaystyle{\operator@font fuse} =ϕ(μ)fragmentsϕ(μ)\displaystyle\;{}={}\;\phi(\mu)

The types in the abstract view are shift:MXM(JX)fragmentsshift:MXM(JX){\operator@font shift}:M\,X\to M\,(J\,X) and fuse:M(JX)MXfragmentsfuse:M(JX)MX{\operator@font fuse}:M\,(J\,X)\to M\,X where J𝐽J denotes the underlying monad. The mapping of morphisms by M𝑀M can be given via ϕitalic-ϕ\phi:

(Fun-Mixmap) MffragmentsMf\displaystyle M\,f =ϕ(Jf)fragmentsϕ(Jf)\displaystyle\;{}={}\;\phi(J\,f)

Assuming this as definition, one can prove the two functor laws for M𝑀M using Mixmap-Id, Mixmap-Comp and the functor laws for J𝐽J. Moreover, the unit of M𝑀M can be expressed by

(Point-RPoint) returnreturn\displaystyle{\operator@font return} =ρηfragmentsρη\displaystyle\;{}={}\;\rho\circ\eta

Proof of naturality of returnreturn{\operator@font return} is straightforward using naturality of η𝜂\eta along with RPoint-RNat and Fun-Mixmap.

We are now going to form an alternative axiom set that uses shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} instead of ϕitalic-ϕ\phi as the underlying operations. Firstly, we include the following laws that resemble the coherence conditions of monad join:

(Fuse-Fuse) fuseMμfragmentsfuseMμ\displaystyle{\operator@font fuse}\circ M\,\mu =fusefusefragmentsfusefuse\displaystyle\;{}={}\;{\operator@font fuse}\circ{\operator@font fuse}
(Fuse-FunPoint) fuseMηfragmentsfuseMη\displaystyle{\operator@font fuse}\circ M\,\eta =idfragmentsid\displaystyle\;{}={}\;{\operator@font id}
(Fuse-Shift) fuseshiftfragmentsfuseshift\displaystyle{\operator@font fuse}\circ{\operator@font shift} =idfragmentsid\displaystyle\;{}={}\;{\operator@font id}

Secondly, we include the following two homomorphism laws for shiftshift{\operator@font shift}:

(Shift-PointHom) shiftρfragmentsshiftρ\displaystyle{\operator@font shift}\circ\rho =returnfragmentsreturn\displaystyle\;{}={}\;{\operator@font return}
(Shift-RNat) shiftϕ(g)fragmentsshiftϕ(g)\displaystyle{\operator@font shift}\circ\phi(g) =MgshiftfragmentsMgshift\displaystyle\;{}={}\;M\,g\circ{\operator@font shift}

Note that Shift-PointHom and Shift-RNat uniquely determine ρ𝜌\rho and ϕitalic-ϕ\phi. Hence there is no need to include direct definitions of ρ𝜌\rho and ϕitalic-ϕ\phi; but if we did it, ρ𝜌\rho would be given by

(RPoint-Point) ρ𝜌\displaystyle\rho =fusereturnfragmentsfusereturn\displaystyle\;{}={}\;{\operator@font fuse}\circ{\operator@font return}

and ϕitalic-ϕ\phi by Mixmap-FuseShift (for proof, compose Shift-PointHom and Shift-RNat with fusefuse{\operator@font fuse} from the left and apply Fuse-Shift). Then we could replace Shift-PointHom and Shift-RNat with axioms not mentioning ρ𝜌\rho and ϕitalic-ϕ\phi to obtain an axiomatization expressed fully in terms of shiftshift{\operator@font shift} and fusefuse{\operator@font fuse}. We prefer the homomorphism laws for brevity and elegance.

Altogether, we have the following result that establishes equivalence of the axiomatics of ϕitalic-ϕ\phi and the axiomatics of shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} in every category:

Theorem 6.1.

Let (J,η,μ)fragments(J,η,μ)(J,\eta,\mu) be a monad. Suppose that M𝑀M consists of a mapping of objects to objects and a type-preserving mapping of morphisms to morphisms. (This is to say that M𝑀M is an endofunctor without assuming functor laws.) Furthermore, assume transformations ρ:JXMXfragmentsρ:JXMX\rho:J\,X\to M\,X, return:XMXfragmentsreturn:XMX{\operator@font return}:X\to M\,X, shift:MXM(JX)fragmentsshift:MXM(JX){\operator@font shift}:M\,X\to M\,(J\,X) and fuse:M(JX)MXfragmentsfuse:M(JX)MX{\operator@font fuse}:M\,(J\,X)\to M\,X along with ϕitalic-ϕ\phi that maps morphisms of type JXJXfragmentsJXJXJ\,X\to J\,X^{\prime} to morphisms of type MXMXfragmentsMXMXM\,X\to M\,X^{\prime} being given. Then the set of laws consisting of RPoint-RNat, Mixmap-Id, Mixmap-Comp, Shift-Mixmap, Fuse-Mixmap, Fun-Mixmap and Point-RPoint is equivalent to the set of laws consisting of:

The proofs are straightforward.

We have not mentioned naturality of ρ𝜌\rho and shiftshift{\operator@font shift}; both are implied by the axioms considered. One can also deduce the following dual of Fuse-Fuse law from the axioms:

(Shift-Shift) MηshiftfragmentsMηshift\displaystyle M\,\eta\circ{\operator@font shift} =shiftshiftfragmentsshiftshift\displaystyle\;{}={}\;{\operator@font shift}\circ{\operator@font shift}

6.2. Two-Story Monads

So far, bind operation of M𝑀M was not involved into our study. At the third level of the hierarchy defined in Sect. 4 for exceptions, we also had a “joint handle” function of type (E+AF(E,A))F(E,A)F(E,A)fragments(EAF(E,A))F(E,A)F(E,A)(E+A\to F\,(E^{\prime},A^{\prime}))\to F\,(E,A)\to F\,(E^{\prime},A^{\prime}) generalizing the monad bind; we noted that its type equals the type of bind of a relative monad on ++ but it unfortunately does not meet all relative monad laws. One can also define a similar function of type (X×WMX)MXMXfragments(XWMX)MXMX(X\times W\to M\,X^{\prime})\to M\,X\to M\,X^{\prime} that takes the current log along with the return value into account when binding two computations with writer effects. All relative monad laws turn out to be satisfied for all structures constructed via the four monad transformers we consider in this paper. Therefore we start axiomatizing of the third level from the relative monad laws (with, again, J𝐽J replacing the writer monad):

(RBnd-UnitL) k\coAsteriskρfragmentsk\coAsteriskρ\displaystyle k{}^{\coAsterisk}\circ\rho =kfragmentsk\displaystyle\;{}={}\;k
(RBnd-Id) ρ\coAsteriskfragmentsρ\coAsterisk\displaystyle\rho{}^{\coAsterisk} =idfragmentsid\displaystyle\;{}={}\;{\operator@font id}
(RBnd-Assoc) l\coAsteriskk\coAsteriskfragmentsl\coAsteriskk\coAsterisk\displaystyle l{}^{\coAsterisk}\circ k{}^{\coAsterisk} =(l\coAsteriskk)\coAsteriskfragments(l\coAsteriskk)\coAsterisk\displaystyle\;{}={}\;(l{}^{\coAsterisk}\circ k){}^{\coAsterisk}
(Fun-RBnd) MffragmentsMf\displaystyle M\,f =(ρJf)\coAsteriskfragments(ρJf)\coAsterisk\displaystyle\;{}={}\;(\rho\circ J\,f){}^{\coAsterisk}

In order to be able to express the usual monad bind of type (XMX)MXMXfragments(XMX)MXMX(X\to M\,X^{\prime})\to M\,X\to M\,X^{\prime} in terms of the relative monad bind whose type in the case of an abstract base functor J𝐽J is (JXMX)MXMXfragments(JXMX)MXMX(J\,X\to M\,X^{\prime})\to M\,X\to M\,X^{\prime}, we consider a pseudobind (_)fragments(_)(\_){}^{\sharp} of type (XMX)JXMXfragments(XMX)JXMX(X\to M\,X^{\prime})\to J\,X\to M\,X^{\prime}. Then one can define bind of M𝑀M, denoted by (_)fragments(_)exclusive-or(\_){}^{\veebar}, by

(Bnd-PBndRBnd) kfragmentskexclusive-or\displaystyle k{}^{\veebar} =k\coAsteriskfragmentsk\coAsterisk\displaystyle\;{}={}\;k{}^{\sharp}{}^{\coAsterisk}

(We use the half-star notation for bind of M𝑀M and leave the standard notation (_)fragments(_)(\_)^{*} for bind of the monad J𝐽J. The term pseudobind was chosen after Steele Jr. (DBLP:conf/popl/Steele94); we will discuss Steele’s work in Subsect. 6.3.) In the writer case, we can take

(PBnd-Bifun) kfragmentsk\displaystyle k{}^{\sharp} =(a,w)F((w),id)(ka),fragments(a,w)F((w),id)(ka),\displaystyle\;{}={}\;\qlam(a,w)\centerdot F\,((w\cdot{}),{\operator@font id})\,(k\,a)\mbox{,}

where the section notation of Haskell is used in the first argument of F𝐹F, which itself is the bifunctor obtained from M𝑀M by treating W𝑊W as its (first) parameter. (The type W𝑊W is still fixed. The domain of the additional parameter of F𝐹F is the category consisting of a singleton object W𝑊W and its endomorphisms.) So kfragmentskk{}^{\sharp} takes a pair (a,w)fragments(a,w)(a,w), applies k𝑘k to a𝑎a and multiplies the log of the computation by w𝑤w from the left. We could not use ϕ(id×(w))fragmentsϕ(id(w))\phi({\operator@font id}\times(w\cdot{})) instead as the exception monad transformer does not preserve the equality F(f,id)=ϕ(id×f)fragmentsF(f,id)ϕ(idf)F(f,{\operator@font id})=\phi({\operator@font id}\times f). We will study F𝐹F more in Subsect. 6.4.

For (_)fragments(_)(\_){}^{\sharp}, we use the following monad-like axioms:

(PBnd-UnitL) kηfragmentskη\displaystyle k{}^{\sharp}\circ\eta =kfragmentsk\displaystyle\;{}={}\;k
(PBnd-RPoint) (ρf)fragments(ρf)\displaystyle(\rho\circ f){}^{\sharp} =ρffragmentsρf\displaystyle\;{}={}\;\rho\circ f^{*}
(PBndBnd-Assoc) lkfragmentslexclusive-ork\displaystyle l{}^{\veebar}\circ k{}^{\sharp} =(lk)fragments(lexclusive-ork)\displaystyle\;{}={}\;(l{}^{\veebar}\circ k){}^{\sharp}

But how to express the relative monad bind in terms of the bind of M𝑀M? The functions shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} studied in connection with mixmap can help. Firstly, we can define ϕitalic-ϕ\phi via (_)\coAsteriskfragments(_)\coAsterisk(\_){}^{\coAsterisk} by generalizing Fun-RBnd:

(Mixmap-RBnd) ϕ(g)fragmentsϕ(g)\displaystyle\phi(g) =(ρg)\coAsteriskfragments(ρg)\coAsterisk\displaystyle\;{}={}\;(\rho\circ g){}^{\coAsterisk}

Then shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} are expressible via ϕitalic-ϕ\phi by Shift-Mixmap and Fuse-Mixmap; hence these functions are definable in our “two-story monad” framework. Now we achieve an equivalent axiomatics in terms of monad M𝑀M, shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} if we add the following axioms, the first two of which are for defining (_)\coAsteriskfragments(_)\coAsterisk(\_){}^{\coAsterisk} and (_)fragments(_)(\_){}^{\sharp}, to the union of monad axioms for M𝑀M and the previously seen axioms of shiftshift{\operator@font shift} and fusefuse{\operator@font fuse}:

(Shift-BndHom) shiftk\coAsteriskfragmentsshiftk\coAsterisk\displaystyle{\operator@font shift}\circ k{}^{\coAsterisk} =(shiftk)shiftfragments(shiftk)exclusive-orshift\displaystyle\;{}={}\;({\operator@font shift}\circ k){}^{\veebar}\circ{\operator@font shift}
(PBnd-Bnd) kfragmentsk\displaystyle k{}^{\sharp} =kρfragmentskexclusive-orρ\displaystyle\;{}={}\;k{}^{\veebar}\circ\rho
(Bnd-RPoint) ρfragmentsρexclusive-or\displaystyle\rho{}^{\veebar} =fusefragmentsfuse\displaystyle\;{}={}\;{\operator@font fuse}

The previously established axiomatics for shiftshift{\operator@font shift} and fusefuse{\operator@font fuse} declares shiftshift{\operator@font shift} to be a homomorphism between the relative point and point, as well as between mixmap and functor; Shift-BndHom extends this pattern also to the third level. It enables to express (_)\coAsteriskfragments(_)\coAsterisk(\_){}^{\coAsterisk} via (_)fragments(_)exclusive-or(\_){}^{\veebar} as

(RBnd-Bnd) k\coAsteriskfragmentsk\coAsterisk\displaystyle k{}^{\coAsterisk} =kshiftfragmentskexclusive-orshift\displaystyle\;{}={}\;k{}^{\veebar}\circ{\operator@font shift}

Indeed:

k\coAsteriskfragmentsk\coAsterisk\displaystyle k{}^{\coAsterisk}
=fragments\displaystyle\;{}={}\; Fuse-Shift, identityfragmentsFuse-Shift, identity\displaystyle\Lbag\mbox{\ref{writer:fuse-shift}, identity}\Rbag
fuseshiftk\coAsteriskfragmentsfuseshiftk\coAsterisk\displaystyle{\operator@font fuse}\circ{\operator@font shift}\circ k{}^{\coAsterisk}
=fragments\displaystyle\;{}={}\; Bnd-RPointShift-BndHomfragmentsBnd-RPointShift-BndHom\displaystyle\Lbag\mbox{\ref{writer:bnd-rpoint}, \ref{writer:shift-bndhom}}\Rbag
ρ(shiftk)shiftfragmentsρexclusive-or(shiftk)exclusive-orshift\displaystyle\rho{}^{\veebar}\circ({\operator@font shift}\circ k){}^{\veebar}\circ{\operator@font shift}
=fragments\displaystyle\;{}={}\; monadfragmentsmonad\displaystyle\Lbag\mbox{monad}\Rbag
(ρshiftk)shiftfragments(ρexclusive-orshiftk)exclusive-orshift\displaystyle(\rho{}^{\veebar}\circ{\operator@font shift}\circ k){}^{\veebar}\circ{\operator@font shift}
=fragments\displaystyle\;{}={}\; Bnd-RPointfragmentsBnd-RPoint\displaystyle\Lbag\mbox{\ref{writer:bnd-rpoint}}\Rbag
(fuseshiftk)shiftfragments(fuseshiftk)exclusive-orshift\displaystyle({\operator@font fuse}\circ{\operator@font shift}\circ k){}^{\veebar}\circ{\operator@font shift}
=fragments\displaystyle\;{}={}\; Fuse-Shift, identityfragmentsFuse-Shift, identity\displaystyle\Lbag\mbox{\ref{writer:fuse-shift}, identity}\Rbag
kshiftfragmentskexclusive-orshift\displaystyle k{}^{\veebar}\circ{\operator@font shift}

Note also that the laws imply ρ𝜌\rho being a monad morphism: Point-RPoint states preservation of unit, and PBnd-RPoint and PBnd-Bnd together establish preservation of bind.

Our main result of the current section is formalized by the following theorem, which again is correct for an arbitrary category:

Theorem 6.2.

Let (J,η,μ)fragments(J,η,μ)(J,\eta,\mu) be a monad, let M𝑀M be given as in Theorem 6.1, and let ρ𝜌\rho, returnreturn{\operator@font return}, shiftshift{\operator@font shift}, fusefuse{\operator@font fuse} and ϕitalic-ϕ\phi be given with the same types as in Theorem 6.1. Moreover, assume:

(_)fragments(_)exclusive-or\displaystyle(\_){}^{\veebar} :(XMX)MXMXfragments:(XMX)MXMX\displaystyle\;{}:{}\;(X\to M\,X^{\prime})\to M\,X\to M\,X^{\prime}
(_)\coAsteriskfragments(_)\coAsterisk\displaystyle(\_){}^{\coAsterisk} :(JXMX)MXMXfragments:(JXMX)MXMX\displaystyle\;{}:{}\;(J\,X\to M\,X^{\prime})\to M\,X\to M\,X^{\prime}
(_)fragments(_)\displaystyle(\_){}^{\sharp} :(XMX)JXMXfragments:(XMX)JXMX\displaystyle\;{}:{}\;(X\to M\,X^{\prime})\to J\,X\to M\,X^{\prime}

Then the set consisting of the laws RBnd-UnitL, RBnd-Id, RBnd-Assoc, PBnd-UnitL, PBnd-RPoint, PBndBnd-Assoc, Mixmap-RBnd, Fun-RBnd (or: Fun-Mixmap), Shift-Mixmap, Fuse-Mixmap, Point-RPoint and Bnd-PBndRBnd is equivalent to the axiomatics consisting of:

  • Naturality of fusefuse{\operator@font fuse};

  • Three coherence laws of fusefuse{\operator@font fuse};

  • Three homomorphism laws of shiftshift{\operator@font shift} (Shift-PointHom, Shift-RNat and Shift-BndHom);

  • Four monad laws of M𝑀M (including the definition of the morphism mapping of M𝑀M);

The proofs are straightforward. In the light of the ability of expressing the operations used in this paper and the 𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟𝑀𝑜𝑛𝑎𝑑𝑊𝑟𝑖𝑡𝑒𝑟\mathit{MonadWriter} class methods in terms of each other, we also have the following result:

Theorem 6.3.

Let M𝑀M be any monad in the category 𝐒𝐞𝐭fragmentsSet\boldsymbol{Set}. Then:

  • The monad obtained by applying the writer monad transformer to M𝑀M, with methods defined as in MTL, satisfies all laws mentioned in Theorem 6.2 and also PBnd-Bifun;

  • Applying the exception, reader, writer, and state monad transformers preserve the laws.

6.3. Connections to Steele’s Pseudomonads

Our two-story monads are close to the pseudomonad towers studied by Steele Jr. (DBLP:conf/popl/Steele94). That classic paper aims to find ways to join different monadic effects by “composing” the carrier monads of each particular effect. As monads are not always behaving nicely under composition, it introduces pseudomonads that generalize monads by allowing the target type of the function under bind to differ from the source type of the function produced by bind (the target types of the function under bind and of that produced by bind still coincide). Unit and bind of a pseudomonad are called pseudounit and pseudobind. In this sense, our operation (_)fragments(_)(\_){}^{\sharp} along with the unit η𝜂\eta of monad J𝐽J are pseudobind and pseudounit of a pseudomonad. The notion of monad itself as treated in (DBLP:conf/popl/Steele94) is wider than standard and subsumes also relative monads.

That paper modifies the standard monad axioms to be applicable to pseudomonads. Here are Steele’s axioms, written in the language of our paper:

(Steele-UnitL) kηfragmentskη\displaystyle k{}^{\sharp}\circ\eta =kfragmentsk\displaystyle\;{}={}\;k
(Steele-UnitR) (hη)fragments(hη)\displaystyle(h\circ\eta){}^{\sharp} =hfragmentsh\displaystyle\;{}={}\;h
(Steele-Assoc) lkfragmentslk\displaystyle l{}^{\sharp}\circ k^{*} =(lk)fragments(lk)\displaystyle\;{}={}\;(l{}^{\sharp}\circ k){}^{\sharp}

Of these, Steele-UnitL coincides with our axiom PBnd-UnitL. But the next axiom, Steele-UnitR, is not valid in general. It implies that every function of type JXMXfragmentsJXMXJ\,X\to M\,X^{\prime} is a result of pseudobind—and in particular, every function of type JXJXfragmentsJXJXJ\,X\to J\,X^{\prime} is a result of bind, which is clearly not true. The last axiom, Steele-Assoc, is a theorem in our axiomatics, provable as follows:

lkfragmentslk\displaystyle l{}^{\sharp}\circ k^{*}
=fragments\displaystyle\;{}={}\; PBnd-BndfragmentsPBnd-Bnd\displaystyle\Lbag\mbox{\ref{writer:pbnd-bnd}}\Rbag
lρkfragmentslexclusive-orρk\displaystyle l{}^{\veebar}\circ\rho\circ k^{*}
=fragments\displaystyle\;{}={}\; PBnd-RPointfragmentsPBnd-RPoint\displaystyle\Lbag\mbox{\ref{writer:pbnd-unitr}}\Rbag
l(ρk)fragmentslexclusive-or(ρk)\displaystyle l{}^{\veebar}\circ(\rho\circ k){}^{\sharp}
=fragments\displaystyle\;{}={}\; PBndBnd-AssocfragmentsPBndBnd-Assoc\displaystyle\Lbag\mbox{\ref{writer:pbndbnd-assoc}}\Rbag
(lρk)fragments(lexclusive-orρk)\displaystyle(l{}^{\veebar}\circ\rho\circ k){}^{\sharp}
=fragments\displaystyle\;{}={}\; PBnd-BndfragmentsPBnd-Bnd\displaystyle\Lbag\mbox{\ref{writer:pbnd-bnd}}\Rbag
(lk)fragments(lk)\displaystyle(l{}^{\sharp}\circ k){}^{\sharp}

We were not able to prove PBndBnd-Assoc from Steele-Assoc, so it seems that Steele-Assoc is strictly weaker than PBndBnd-Assoc. (This does not mean a flaw in (DBLP:conf/popl/Steele94). The weaker axiom might be perfect for the purposes of that paper which aims to involve cases where the monad obtained by composition does not satisfy associativity. In our axiomatics, associativity of monad M𝑀M is forced by the laws of its constituent pseudomonad and relative monad.)

6.4. Some Corollaries and Non-Corollaries

In this subsection, we are working in the category 𝑺𝒆𝒕fragmentsSet\boldsymbol{Set}. According to the class definition given at the beginning of Sect. 6, one can express

tell=ρ(const()id).fragmentstellρ(const()id).{\operator@font tell}=\rho\circ(\mathop{{\operator@font const}}\nolimits()\both{\operator@font id})\mbox{.}

Using the theory developed above, any expression of the form tellw>>tfragmentstellwfragmentst{\operator@font tell}\,w\mathbin{>\!\!\!>}t can be rewritten as (constt)((),w)fragments(constt)((),w)(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,((),w). (Rewrite tellwfragmentstellw{\operator@font tell}\,w and >>fragments\mathbin{>\!\!\!>} by their meaning and apply PBnd-Bnd.) On the other hand, PBnd-Bifun allows to conclude that

(Bifun-PBnd) (constt)((),w)fragments(constt)((),w)\displaystyle(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,((),w) =F((w),id)tfragmentsF((w),id)t\displaystyle\;{}={}\;F\,((w\cdot{}),{\operator@font id})\,t

Therefore, bifunctor applications of the form F((w),id)tfragmentsF((w),id)tF\,((w\cdot{}),{\operator@font id})\,t are equivalent to tellw>>tfragmentstellwfragmentst{\operator@font tell}\,w\mathbin{>\!\!\!>}t. Using Bifun-PBnd as the definition of such bifunctor applications, we can prove that they satisfy the functor laws. For identity:

idid\displaystyle{\operator@font id}
=fragments\displaystyle\;{}={}\; identity, constantfragmentsidentity, constant\displaystyle\Lbag\mbox{identity, constant}\Rbag
tconstt()fragmentstconstt()\displaystyle\qlam t\centerdot\mathop{{\operator@font const}}\nolimits t\,()
=fragments\displaystyle\;{}={}\; PBnd-UnitLfragmentsPBnd-UnitL\displaystyle\Lbag\mbox{\ref{writer:pbnd-unitl}}\Rbag
t(constt)(η())fragmentst(constt)(η())\displaystyle\qlam t\centerdot(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,(\eta\,())
=fragments\displaystyle\;{}={}\; writerfragmentswriter\displaystyle\Lbag\mbox{writer}\Rbag
t(constt)((),1)fragmentst(constt)((),1)\displaystyle\qlam t\centerdot(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,((),\mbox{{1}})
=fragments\displaystyle\;{}={}\; Bifun-PBnd, extensionalityfragmentsBifun-PBnd, extensionality\displaystyle\Lbag\mbox{\ref{writer:bifun-pbnd}, extensionality}\Rbag
F((1),id)fragmentsF((1),id)\displaystyle F\,((\mbox{{1}}\cdot{}),{\operator@font id})
=fragments\displaystyle\;{}={}\; monoid unitfragmentsmonoid unit\displaystyle\Lbag\mbox{monoid unit}\Rbag
F(id,id)fragmentsF(id,id)\displaystyle F\,({\operator@font id},{\operator@font id})

For composition,

F((w),id)F((w),id)fragmentsF((w),id)F((w),id)\displaystyle F\,((w^{\prime}\cdot{}),{\operator@font id})\circ F\,((w\cdot{}),{\operator@font id})
=fragments\displaystyle\;{}={}\; compositionfragmentscomposition\displaystyle\Lbag\mbox{composition}\Rbag
tF((w),id)(F((w),id)t)fragmentstF((w),id)(F((w),id)t)\displaystyle\qlam t\centerdot F\,((w^{\prime}\cdot{}),{\operator@font id})\,(F\,((w\cdot{}),{\operator@font id})\,t)
=fragments\displaystyle\;{}={}\; Bifun-PBnd twicefragmentsBifun-PBnd twice\displaystyle\Lbag\mbox{\ref{writer:bifun-pbnd} twice}\Rbag
t(const((constt)((),w)))((),w)fragmentst(const((constt)((),w)))((),w)\displaystyle\qlam t\centerdot(\mathop{{\operator@font const}}\nolimits((\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,((),w))){}^{\sharp}\,((),w^{\prime})
=fragments\displaystyle\;{}={}\; constant, product, ()fragmentsconstant, product, ()\displaystyle\Lbag\mbox{constant, product, $()$}\Rbag
t((constt)(idconstw))((),w)fragmentst((constt)(idconstw))((),w)\displaystyle\qlam t\centerdot((\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\circ({\operator@font id}\both\mathop{{\operator@font const}}\nolimits w)){}^{\sharp}\,((),w^{\prime})
=fragments\displaystyle\;{}={}\; Steele-AssocfragmentsSteele-Assoc\displaystyle\Lbag\mbox{\ref{writer:steele-assoc}}\Rbag
t((constt)(idconstw))((),w)fragmentst((constt)(idconstw))((),w)\displaystyle\qlam t\centerdot((\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\circ({\operator@font id}\both\mathop{{\operator@font const}}\nolimits w)^{*})\,((),w^{\prime})
=fragments\displaystyle\;{}={}\; compositionfragmentscomposition\displaystyle\Lbag\mbox{composition}\Rbag
t(constt)((idconstw)((),w))fragmentst(constt)((idconstw)((),w))\displaystyle\qlam t\centerdot(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,(({\operator@font id}\both\mathop{{\operator@font const}}\nolimits w)^{*}\,((),w^{\prime}))
=fragments\displaystyle\;{}={}\; writerfragmentswriter\displaystyle\Lbag\mbox{writer}\Rbag
t(constt)((id×(w))((idconstw)()))fragmentst(constt)((id(w))((idconstw)()))\displaystyle\qlam t\centerdot(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,(({\operator@font id}\times(w^{\prime}\cdot{}))\,(({\operator@font id}\both\mathop{{\operator@font const}}\nolimits w)\,()))
=fragments\displaystyle\;{}={}\; product, constantfragmentsproduct, constant\displaystyle\Lbag\mbox{product, constant}\Rbag
t(constt)((),ww)fragmentst(constt)((),ww)\displaystyle\qlam t\centerdot(\mathop{{\operator@font const}}\nolimits t){}^{\sharp}\,((),w^{\prime}\cdot w)
=fragments\displaystyle\;{}={}\; Bifun-PBnd, extensionalityfragmentsBifun-PBnd, extensionality\displaystyle\Lbag\mbox{\ref{writer:bifun-pbnd}, extensionality}\Rbag
F((ww),id)fragmentsF((ww),id)\displaystyle F\,((w^{\prime}\cdot w\cdot{}),{\operator@font id})
=fragments\displaystyle\;{}={}\; monoid associativityfragmentsmonoid associativity\displaystyle\Lbag\mbox{monoid associativity}\Rbag
F((w)(w),id)fragmentsF((w)(w),id)\displaystyle F\,((w^{\prime}\cdot{})\circ(w\cdot{}),{\operator@font id})

The latter implies the equation

tellw>>tellw=tell(ww)fragmentstellwfragmentstellwtell(ww){\operator@font tell}\,w\mathbin{>\!\!\!>}{\operator@font tell}\,w^{\prime}={\operator@font tell}\,(w\cdot w^{\prime})

(for proof, rewrite tellw=tellw>>return()fragmentstellwtellwfragmentsreturn(){\operator@font tell}\,w^{\prime}={\operator@font tell}\,w^{\prime}\mathbin{>\!\!\!>}\mathop{{\operator@font return}}\nolimits() and later the same for wwfragmentswww\cdot w^{\prime}).

We leave the proofs of the following two corollaries as an exercise:

(RPoint-Binat) ρ(id×(w))fragmentsρ(id(w))\displaystyle\rho\circ({\operator@font id}\times(w\cdot{})) =F((w),id)ρfragmentsF((w),id)ρ\displaystyle\;{}={}\;F\,((w\cdot{}),{\operator@font id})\circ\rho
(Bifun-Bnd-Comm) F((w),id)kfragmentsF((w),id)kexclusive-or\displaystyle F\,((w\cdot{}),{\operator@font id})\circ k{}^{\veebar} =kF((w),id)fragmentskexclusive-orF((w),id)\displaystyle\;{}={}\;k{}^{\veebar}\circ F\,((w\cdot{}),{\operator@font id})

Finally, there are laws that cannot be deduced from the developed theory but are valid in all monads constructible by applying the writer monad transformer to any monad and preserved by the exception, reader, writer and state monad transformers. For instance:

  • RPoint-Binat stays true after replacing (w)fragments(w)(w\cdot{}) with arbitrary f:WWfragmentsf:WWf:W\to W;

  • For any monoid endomorphism hh, mapping of the computation log by hh is a monad homomorphism:

    (Bifun-UnitHom) F(h,id)returnfragmentsF(h,id)return\displaystyle F\,(h,{\operator@font id})\circ{\operator@font return} =returnfragmentsreturn\displaystyle\;{}={}\;{\operator@font return}
    (Bifun-BndHom) F(h,id)kfragmentsF(h,id)kexclusive-or\displaystyle F\,(h,{\operator@font id})\circ k{}^{\veebar} =(F(h,id)k)F(h,id)fragments(F(h,id)k)exclusive-orF(h,id)\displaystyle\;{}={}\;(F\,(h,{\operator@font id})\circ k){}^{\veebar}\circ F\,(h,{\operator@font id})

7. Stateful Computations

In MTL, the class of stateful monads is introduced as follows:


\pboxed\column

B@¿l¡@\column5@¿l¡@\column14@¿l¡@\column17@¿l¡@\column19@¿l¡@\columnE@¿l¡@ [B]classMonadmMonadStatesmmswhere\<[E]
 [B] \<[5] [5]get\<[14] [14]::ms\<[E]
 [B] \<[5] [5]get\<[14] [14]=\<[17] [17]state (λs→(s,s))\<[E]
 [B] \<[5] [5]put\<[14] [14]

Conversion to HTML had a Fatal error and exited abruptly. This document may be truncated or damaged.