Consciousness as a State of Matter

Max Tegmark Dept. of Physics & MIT Kavli Institute, Massachusetts Institute of Technology, Cambridge, MA 02139
(Accepted for publication in Chaos, Solitons & Fractals March 17, 2015)
Abstract

We examine the hypothesis that consciousness can be understood as a state of matter, “perceptronium”, with distinctive information processing abilities. We explore four basic principles that may distinguish conscious matter from other physical systems such as solids, liquids and gases: the information, integration, independence and dynamics principles. If such principles can identify conscious entities, then they can help solve the quantum factorization problem: why do conscious observers like us perceive the particular Hilbert space factorization corresponding to classical space (rather than Fourier space, say), and more generally, why do we perceive the world around us as a dynamic hierarchy of objects that are strongly integrated and relatively independent? Tensor factorization of matrices is found to play a central role, and our technical results include a theorem about Hamiltonian separability (defined using Hilbert-Schmidt superoperators) being maximized in the energy eigenbasis. Our approach generalizes Giulio Tononi’s integrated information framework for neural-network-based consciousness to arbitrary quantum systems, and we find interesting links to error-correcting codes, condensed matter criticality, and the Quantum Darwinism program, as well as an interesting connection between the emergence of consciousness and the emergence of time.

I Introduction

I.1 Consciousness in physics

A commonly held view is that consciousness is irrelevant to physics and should therefore not be discussed in physics papers. One oft-stated reason is a perceived lack of rigor in past attempts to link consciousness to physics. Another argument is that physics has been managed just fine for hundreds of years by avoiding this subject, and should therefore keep doing so. Yet the fact that most physics problems can be solved without reference to consciousness does not guarantee that this applies to all physics problems. Indeed, it is striking that many of the most hotly debated issues in physics today involve the notions of observations and observers, and we cannot dismiss the possibility that part of the reason why these issues have resisted resolution for so long is our reluctance as physicists to discuss consciousness and attempt to rigorously define what constitutes an observer.

For example, does the non-observability of spacetime regions beyond horizons imply that they in some sense do not exist independently of the regions that we can observe? This question lies at the heart of the controversies surrounding the holographic principle, black hole complementarity and firewalls, and depends crucially on the role of observers Almheiri12 ; Banks14 . What is the solution to the quantum measurement problem? This again hinges crucially on the role of observation: does the wavefunction undergo a non-unitary collapse when an observation is made, are there Everettian parallel universes, or does it make no sense to talk about an an observer-independent reality, as argued by QBism advocates SaundersBook ? Is our persistent failure to unify general relativity with quantum mechanics linked to the different roles of observers in the two theories? After all, the idealized observer in general relativity has no mass, no spatial extent and no effect on what is observed, whereas the quantum observer notoriously does appear to affect the quantum state of the observed system. Finally, out of all of the possible factorizations of Hilbert space, why is the particular factorization corresponding to classical space so special? Why do we observers perceive ourselves are fairly local in real space as opposed to Fourier space, say, which according to the formalism of quantum field theory corresponds to an equally valid Hilbert space factorization? This “quantum factorization problem” appears intimately related to the nature of an observer.

The only issue there is consensus on is that there is no consensus about how to define an observer and its role. One might hope that a detailed observer definition will prove unnecessary because some simple properties such as the ability to record information might suffice; however, we will see that at least two more properties of observers may be necessary to solve the quantum factorization problem, and that a closer examination of consciousness may be required to identify these properties.

Another commonly held view is that consciousness is unrelated to quantum mechanics because the brain is a wet, warm system where decoherence destroys quantum superpositions of neuron firing much faster than we can think, preventing our brain from acting as a quantum computer brain . In this paper, I argue that consciousness and quantum mechanics are nonetheless related, but in a different way: it is not so much that quantum mechanics is relevant to the brain, as the other way around. Specifically, consciousness is relevant to solving an open problem at the very heart of quantum mechanics: the quantum factorization problem.

I.2 Consciousness in philosophy

Why are you conscious right now? Specifically, why are you having a subjective experience of reading these words, seeing colors and hearing sounds, while the inanimate objects around you are presumably not having any subjective experience at all? Different people mean different things by “consciousness”, including awareness of environment or self. I am asking the more basic question of why you experience anything at all, which is the essence of what philosopher David Chalmers has termed “the hard problem” of consciousness and which has preoccupied philosophers throughout the ages (see Chalmers95 and references therein). A traditional answer to this problem is dualism — that living entities differ from inanimate ones because they contain some non-physical element such as an “anima” or “soul”. Support for dualism among scientists has gradually dwindled with the realization that we are made of quarks and electrons, which as far as we can tell move according to simple physical laws. If your particles really move according to the laws of physics, then your purported soul is having no effect on your particles, so your conscious mind and its ability to control your movements would have nothing to do with a soul. If your particles were instead found not to obey the known laws of physics because they were being pushed around by your soul, then we could treat the soul as just another physical entity able to exert forces on particles, and study what physical laws it obeys, just as physicists have studied new forces fields and particles in the past.

The key assumption in this paper is that consciousness is a property of certain physical systems, with no “secret sauce” or non-physical elements.111More specifically, we pursue an extreme Occam’s razor approach and explore whether all aspects of reality can be derived from quantum mechanics with a density matrix evolving unitarily according to a Hamiltonian. It this approach should turn out to be successful, then all observed aspects of reality must emerge from the mathematical formalism alone: for example, the Born rule for subjective randomness associated with observation would emerge from the underlying deterministic density matrix evolution through Everett’s approach, and both a semiclassical world and consciousness should somehow emerge as well, perhaps though processes generalizing decoherence. Even if quantum gravity phenomena cannot be captured with this simple quantum formalism, it is far from clear that gravitational, relativistic or non-unitary effects are central to understanding consciousness or how conscious observers perceive their immediate surroundings. There is of course no a priori guarantee that this approach will work; this paper is motivated by the view that an Occam’s razor approach is useful if it succeeds and very interesting if it fails, by giving hints as to what alternative assumptions or ingredients are needed. , This transforms Chalmers’ hard problem. Instead of starting with the hard problem of why an arrangement of particles can feel conscious, we will start with the hard fact that some arrangement of particles (such as your brain) do feel conscious while others (such as your pillow) do not, and ask what properties of the particle arrangement make the difference.

This paper is not a comprehensive theory of conciousness. Rather, it is an investigation into the physical properties that conscious systems must have. If we understood what these physical properties were, then we could in principle answer all of the above-mentioned open physics questions by studying the equations of physics: we could identify all conscious entities in any physical system, and calculate what they would perceive. However, this approach is typically not pursued by physicists, with the argument that we do not understand consciousness well enough.

I.3 Consciousness in neuroscience

Arguably, recent progress in neuroscience has fundamentally changed this situation, so that we physicists can no longer blame neuroscientists for our own lack of progress. I have long contended that consciousness is the way information feels when being processed in certain complex ways mmm ; toe2 , i.e., that it corresponds to certain complex patterns in spacetime that obey the same laws of physics as other complex systems. In the seminal paper “Consciousness as Integrated Information: a Provisional Manifesto” TononiManifesto , Giulio Tononi made this idea more specific and useful, making a compelling argument that for an information processing system to be conscious, it needs to have two separate traits:

  1. 1.

    Information: It has to have a large repertoire of accessible states, i.e., the ability to store a large amount of information.

  2. 2.

    Integration: This information must be integrated into a unified whole, i.e., it must be impossible to decompose the system into nearly independent parts, because otherwise these parts would subjectively feel like two separate conscious entities.

Tononi’s work has generated a flurry of activity in the neuroscience community, spanning the spectrum from theory to experiment (see Dehaene11 ; TononiBook ; Casali13 ; IIT3 ; Dehaene14 for recent reviews), making it timely to investigate its implications for physics as well. This is the goal of the present paper — a goal whose pursuit may ultimately provide additional tools for the neuroscience community as well.

Despite its successes, Tononi’s Integrated Information Theory (IIT)222Since it’s inception TononiManifesto , IIT has been further developed IIT3 . In particular, IIT 3.0 considers both the past and the future of a mechanism in a particular state (it’s so-called cause-effect repertoire) and replaces the Kullback-Leibler measure with a proper metric. leaves many questions unanswered. If it is to extend our consciousness-detection ability to animals, computers and arbitrary physical systems, then we need to ground its principles in fundamental physics. IIT takes information, measured in bits, as a starting point. But when we view a brain or computer through our physicists eyes, as myriad moving particles, then what physical properties of the system should be interpreted as logical bits of information? I interpret as a “bit” both the position of certain electrons in my computer s RAM memory (determining whether the micro-capacitor is charged) and the position of certain sodium ions in your brain (determining whether a neuron is firing), but on the basis of what principle? Surely there should be some way of identifying consciousness from the particle motions alone, or from the quantum state evolution, even without this information interpretation? If so, what aspects of the behavior of particles corresponds to conscious integrated information? We will explore different measures of integration below. Neuroscientists have successfully mapped out which brain activation patterns correspond to certain types of conscious experiences, and named these patterns neural correlates of consciousness . How can we generalize this and look for physical correlates of consciousness, defined as the patterns of moving particles that are conscious? What particle arrangements are conscious?

I.4 Consciousness as a state of matter

Generations of physicists and chemists have studied what happens when you group together vast numbers of atoms, finding that their collective behavior depends on the pattern in which they are arranged: the key difference between a solid, a liquid and a gas lies not in the types of atoms, but in their arrangement. In this paper, I conjecture that consciousness can be understood as yet another state of matter. Just as there are many types of liquids, there are many types of consciousness. However, this should not preclude us from identifying, quantifying, modeling and ultimately understanding the characteristic properties that all liquid forms of matter (or all conscious forms of matter) share.

Many
State of long-lived Information Easily Complex?
matter states? integrated? writable? dynamics?
Gas N N N Y
Liquid N N N Y
Solid Y N N N
Memory Y N Y N
Computer Y ? Y Y
Consciousness Y Y Y Y
Table 1: Substances that store or process information can be viewed as novel states of matter and investigated with traditional physics tools.

To classify the traditionally studied states of matter, we need to measure only a small number of physical parameters: viscosity, compressibility, electrical conductivity and (optionally) diffusivity. We call a substance a solid if its viscosity is effectively infinite (producing structural stiffness), and call it a fluid otherwise. We call a fluid a liquid if its compressibility and diffusivity are small and otherwise call it either a gas or a plasma, depending on its electrical conductivity.

What are the corresponding physical parameters that can help us identify conscious matter, and what are the key physical features that characterize it? If such parameters can be identified, understood and measured, this will help us identify (or at least rule out) consciousness “from the outside”, without access to subjective introspection. This could be important for reaching consensus on many currently controversial topics, ranging from the future of artificial intelligence to determining when an animal, fetus or unresponsive patient can feel pain. If would also be important for fundamental theoretical physics, by allowing us to identify conscious observers in our universe by using the equations of physics and thereby answer thorny observation-related questions such as those mentioned in the introductory paragraph.

I.5 Memory

As a first warmup step toward consciousness, let us first consider a state of matter that we would characterize as memory333Neuroscience research has demonstrated that long-term memory is not necessary for consciousness. However, even extremely memory-impaired conscious humans such as Clive Wearing Wilson95 are able to retain information for several seconds; in this paper, I will assume merely that information needs to be remembered long enough to be subjectively experienced — perhaps 0.1 seconds for a human, and much less for entities processing information more rapidly. — what physical features does it have? For a substance to be useful for storing information, it clearly needs to have a large repertoire of possible long-lived states or attractors (see Table 1). Physically, this means that its potential energy function has a large number of well-separated minima. The information storage capacity (in bits) is simply the base-2 logarithm of the number of minima. This equals the entropy (in bits) of the degenerate ground state if all minima are equally deep. For example, solids have many long-lived states, whereas liquids and gases do not: if you engrave someone’s name on a gold ring, the information will still be there years later, but if you engrave it in the surface of a pond, it will be lost within a second as the water surface changes its shape. Another desirable trait of a memory substance, distinguishing it from generic solids, is that it is not only easy to read from (as a gold ring), but also easy to write to: altering the state of your hard drive or your synapses requires less energy than engraving gold.

I.6 Computronium

As a second warmup step, what properties should we ascribe to what Margolus and Toffoli have termed “computronium” computronium , the most general substance that can process information as a computer? Rather than just remain immobile as a gold ring, it must exhibit complex dynamics so that its future state depends in some complicated (and hopefully controllable/programmable) way on the present state. Its atom arrangement must be less ordered than a rigid solid where nothing interesting changes, but more ordered than a liquid or gas. At the microscopic level, computronium need not be particularly complicated, because computer scientists have long known that as long as a device can perform certain elementary logic operations, it is universal: it can be programmed to perform the same computation as any other computer with enough time and memory. Computer vendors often parametrize computing power in FLOPS, floating-point operations per second for 64-bit numbers; more generically, we can parametrize computronium capable of universal computation by “FLIPS”: the number of elementary logical operations such as bit flips that it can perform per second. It has been shown by Lloyd Lloyd99 that a system with average energy E𝐸E can perform a maximum of 4E/h4𝐸4E/h elementary logical operations per second, where hh is Planck’s constant. The performance of today’s best computers is about 38 orders of magnitude lower than this, because they use huge numbers of particles to store each bit and because most of their energy is tied up in a computationally passive form, as rest mass.

I.7 Perceptronium

What about “perceptronium”, the most general substance that feels subjectively self-aware? If Tononi is right, then it should not merely be able to store and process information like computronium does, but it should also satisfy the principle that its information is integrated, forming a unified and indivisible whole.

Let us also conjecture another principle that conscious systems must satisfy: that of autonomy, i.e., that information can be processed with relative freedom from external influence. Autonomy is thus the combination of two separate properties: dynamics and independence. Here dynamics means time dependence (hence information processing capacity) and independence means that the dynamics is dominated by forces from within rather than outside the system. Just like integration, autonomy is postulated to be a necessary but not sufficient condition for a system to be conscious: for example, clocks and diesel generators tend to exhibit high autonomy, but lack substantial information storage capacity.

Principle Definition
Information A conscious system has substantial
     principle      information storage capacity.
Dynamics A conscious system has substantial
     principle      information processing capacity.
Independence A conscious system has substantial
     principle      independence from the rest of the world.
Integration A conscious system cannot consist of
     principle      nearly independent parts.
Autonomy A conscious system has substantial
     principle      dynamics and independence.
Utility An evolved conscious system records mainly
     principle      information that is useful for it.
Table 2: Four conjectured necessary conditions for consciousness that we explore in this paper. The fifth principle simply combines the second and third. The sixth is not a necessary condition, but may explain the evolutionary origin of the others.

I.8 Consciousness and the quantum factorization problem

Table 2 summarizes the four candidate principles that we will explore as necessary conditions for consciousness. Our goal with isolating and studying these principles is not merely to strengthen our understanding of consciousness as a physical process, but also to identify simple traits of conscious matter that can help us tackle other open problems in physics. For example, the only property of consciousness that Hugh Everett needed to assume for his work on quantum measurement was that of the information principle: by applying the Schrödinger equation to systems that could record and store information, he inferred that they would perceive subjective randomness in accordance with the Born rule. In this spirit, we might hope that adding further simple requirements such as in the integration principle, the independence principle and the dynamics principle might suffice to solve currently open problems related to observation. The last principle listed in Table 2, the utility principle, is of a different character than the others: we consider it not as a necessary condition for consciousness, but as a potential unifying evolutionary explanation of the others.

In this paper, we will pay particular attention to what I will refer to as the quantum factorization problem: why do conscious observers like us perceive the particular Hilbert space factorization corresponding to classical space (rather than Fourier space, say), and more generally, why do we perceive the world around us as a dynamic hierarchy of objects that are strongly integrated and relatively independent? This fundamental problem has received almost no attention in the literature Schwindt12 . We will see that this problem is very closely related to the one Tononi confronted for the brain, merely on a larger scale. Solving it would also help solve the “physics-from-scratch” problem toe2 : If the Hamiltonian 𝐇𝐇{\bf H} and the total density matrix ρ𝜌\rho fully specify our physical world, how do we extract 3D space and the rest of our semiclassical world from nothing more than two Hermitian matrices, which come without any a priori physical interpretation or additional structure such as a physical space, quantum observables, quantum field definitions, an “outside” system, etc.? Can some of this information be extracted even from 𝐇𝐇{\bf H} alone, which is fully specified by nothing more than its eigenvalue spectrum? We will see that a generic Hamiltonian cannot be decomposed using tensor products, which would correspond to a decomposition of the cosmos into non-interacting parts — instead, there is an optimal factorization of our universe into integrated and relatively independent parts. Based on Tononi’s work, we might expect that this factorization, or some generalization thereof, is what conscious observers perceive, because an integrated and relatively autonomous information complex is fundamentally what a conscious observer is!


The rest of this paper is organized as follows. In Section II, we explore the integration principle by quantifying integrated information in physical systems, finding encouraging results for classical systems and interesting challenges introduced by quantum mechanics. In Section III, we explore the independence principle, finding that at least one additional principle is required to account for the observed factorization of our physical world into an object hierarchy in three-dimensional space. In Section IV, we explore the dynamics principle and other possibilities for reconciling quantum-mechanical theory with our observation of a semiclassical world. We discuss our conclusions in Section V, including applications of the utility principle, and cover various mathematical details in the three appendices. Throughout the paper, we mainly consider finite-dimensional Hilbert spaces that can be viewed as collections of qubits; as explained in Appendix C, this appears to cover standard quantum field theory with its infinite-dimensional Hilbert space as well.

II Integration

II.1 Our physical world as an object hierarchy

Refer to caption


Figure 1: We perceive the external world as a hierarchy of objects, whose parts are more strongly connected to one another than to the outside. The robustness of an object is defined as the ratio of the integration temperature (the energy per part needed to separate them) to the independence temperature (the energy per part needed to separate the parent object in the hierarchy).

The problem of identifying consciousness in an arbitrary collection of moving particles is similar to the simpler problem of identifying objects there. One of the most striking features of our physical world is that we perceive it as an object hierarchy, as illustrated in Figure 1. If you are enjoying a cold drink, you perceive ice cubes in your glass as separate objects because they are both fairly integrated and fairly independent, e.g., their parts are more strongly connected to one another than to the outside. The same can be said about each of their constituents, ranging from water molecules all the way down to electrons and quarks. Zooming out, you similarly perceive the macroscopic world as a dynamic hierarchy of objects that are strongly integrated and relatively independent, all the way up to planets, solar systems and galaxies. Let us quantify this by defining the robustness of an object as the ratio of the integration temperature (the energy per part needed to separate them) to the independence temperature (the energy per part needed to separate the parent object in the hierarchy). Figure 1 illustrates that all of the ten types of objects shown have robustness of ten or more. A highly robust object preserves its identity (its integration and independence) over a wide range of temperatures/energies/situations. The more robust an object is, the more useful it is for us humans to perceive it as an object and coin a name for it, as per the above-mentioned utility principle.

Returning to the “physics-from-scratch” problem, how can we identify this object hierarchy if all we have to start with are two Hermitian matrices, the density matrix ρ𝜌\rho encoding the state of our world and the Hamiltonian 𝐇𝐇{\bf H} determining its time-evolution? Imagine that we know only these mathematical objects ρ𝜌\rho and 𝐇𝐇{\bf H} and have no information whatsoever about how to interpret the various degrees of freedom or anything else about them. A good beginning is to study integration. Consider, for example, ρ𝜌\rho and 𝐇𝐇{\bf H} for a single deuterium atom, whose Hamiltonian is (ignoring spin interactions for simplicity)

𝐇(𝐫p,𝐩p,𝐫n,𝐩n,𝐫e,𝐩e)=𝐇subscript𝐫𝑝subscript𝐩𝑝subscript𝐫𝑛subscript𝐩𝑛subscript𝐫𝑒subscript𝐩𝑒absent\displaystyle{\bf H}({\bf r}_{p},{\bf p}_{p},{\bf r}_{n},{\bf p}_{n},{\bf r}_{e},{\bf p}_{e})= (1)
=𝐇1(𝐫p,𝐩p,𝐫n,𝐩n)+𝐇2(𝐩e)+𝐇3(𝐫p,𝐩p,𝐫n,𝐩n,𝐫e,𝐩e),absentsubscript𝐇1subscript𝐫𝑝subscript𝐩𝑝subscript𝐫𝑛subscript𝐩𝑛subscript𝐇2subscript𝐩𝑒subscript𝐇3subscript𝐫𝑝subscript𝐩𝑝subscript𝐫𝑛subscript𝐩𝑛subscript𝐫𝑒subscript𝐩𝑒\displaystyle={\bf H}_{1}({\bf r}_{p},{\bf p}_{p},{\bf r}_{n},{\bf p}_{n})+{\bf H}_{2}({\bf p}_{e})+{\bf H}_{3}({\bf r}_{p},{\bf p}_{p},{\bf r}_{n},{\bf p}_{n},{\bf r}_{e},{\bf p}_{e}),

where 𝐫𝐫{\bf r} and 𝐩𝐩{\bf p} are position and momentum vectors, and the subscripts p𝑝p, n𝑛n and e𝑒e refer to the proton, the neutron and the electron. On the second line, we have decomposed 𝐇𝐇{\bf H} into three terms: the internal energy of the proton-neutron nucleus, the internal (kinetic) energy of the electron, and the electromagnetic electron-nucleus interaction. This interaction is tiny, on average involving much less energy than those within the nucleus:

tr𝐇3ρtr𝐇1ρ105,similar-totrsubscript𝐇3𝜌trsubscript𝐇1𝜌superscript105{\hbox{tr}\,{\bf H}_{3}\rho\over\hbox{tr}\,{\bf H}_{1}\rho}\sim 10^{-5}, (2)

which we recognize as the inverse robustness for a typical nucleus in Figure 3. We can therefore fruitfully approximate the nucleus and the electron as separate objects that are almost independent, interacting only weakly with one another. The key point here is that we could have performed this object-finding exercise of dividing the variables into two groups to find the greatest independence (analogous to what Tononi calls “the cruelest cut”) based on the functional form of 𝐇𝐇{\bf H} alone, without even having heard of electrons or nuclei, thereby identifying their degrees of freedom through a purely mathematical exercise.

II.2 Integration and mutual information

If the interaction energy 𝐇3subscript𝐇3{\bf H}_{3} were so small that we could neglect it altogether, then 𝐇𝐇{\bf H} would be decomposable into two parts 𝐇1subscript𝐇1{\bf H}_{1} and 𝐇2subscript𝐇2{\bf H}_{2}, each one acting on only one of the two sub-systems (in our case the nucleus and the electron). This means that any thermal state would be factorizable:

ρe𝐇/kT=e𝐇1/kTe𝐇2/kT=ρ1ρ2,proportional-to𝜌superscript𝑒𝐇𝑘𝑇superscript𝑒subscript𝐇1𝑘𝑇superscript𝑒subscript𝐇2𝑘𝑇subscript𝜌1subscript𝜌2\rho\propto e^{-{\bf H}/kT}=e^{-{\bf H}_{1}/kT}e^{-{\bf H}_{2}/kT}=\rho_{1}\rho_{2}, (3)

so the total state ρ𝜌\rho can be factored into a product of the subsystem states ρ1subscript𝜌1\rho_{1} and ρ2subscript𝜌2\rho_{2}. In this case, the mutual information

IS(ρ1)+S(ρ2)S(ρ)𝐼𝑆subscript𝜌1𝑆subscript𝜌2𝑆𝜌I\equiv S(\rho_{1})+S(\rho_{2})-S(\rho) (4)

vanishes, where

S(ρ)trρlog2ρ𝑆𝜌tr𝜌subscript2𝜌S(\rho)\equiv-\hbox{tr}\,\rho\log_{2}\rho (5)

is the von Neumann entropy (in bits) — which is simply the Shannon entropy of eigenvalues of ρ𝜌\rho. Even for non-thermal states, the time-evolution operator 𝐔𝐔{\bf U} becomes separable:

𝐔ei𝐇t/=ei𝐇1t/ei𝐇2t/=𝐔1𝐔2,𝐔superscript𝑒𝑖𝐇𝑡Planck-constant-over-2-pisuperscript𝑒𝑖subscript𝐇1𝑡Planck-constant-over-2-pisuperscript𝑒𝑖subscript𝐇2𝑡Planck-constant-over-2-pisubscript𝐔1subscript𝐔2{\bf U}\equiv e^{i{\bf H}t/\hbar}=e^{i{\bf H}_{1}t/\hbar}e^{i{\bf H}_{2}t/\hbar}={\bf U}_{1}{\bf U}_{2}, (6)

which (as we will discuss in detail in Section III) implies that the mutual information stays constant over time and no information is ever exchanged between the objects. In summary, if a Hamiltonian can be decomposed without an interaction term (with 𝐇3=0subscript𝐇30{\bf H}_{3}=0), then it describes two perfectly independent systems.444Note that in this paper, we are generally considering 𝐇𝐇{\bf H} and ρ𝜌\rho for the entire cosmos, so that there is no “outside” containing observers etc. If 𝐇3=0subscript𝐇30{\bf H}_{3}=0, entanglement between the two systems thus cannot have any observable effects. This is in stark contrast to most textbook quantum mechanics considerations, where one studies a small subsystem of the world.

Let us now consider the opposite case, when a system cannot be decomposed into independent parts. Let us define the integrated information ΦΦ\Phi as the mutual information I𝐼I for the “cruelest cut” (the cut minimizing I𝐼I) in some class of cuts that subdivide the system into two (we will discuss many different classes of cuts below). Although our ΦΦ\Phi-definition is slightly different from Tononi’s TononiManifesto 555Tononi’s definition of ΦΦ\Phi TononiManifesto applies only for classical systems, whereas we wish to study the quantum case as well. Our ΦΦ\Phi is measured in bits and can grow with system size like an extrinsic variable, whereas his is an intrinsic variable akin representing a sort of average integration per bit., it is similar in spirit, and we are reusing his ΦΦ\Phi-symbol for its elegant symbolism (unifying the shapes of I𝐼I for information and O𝑂O for integration).

II.3 Maximizing integration

Refer to caption

Figure 2: The panels show simulations of the 2D Ising model on a 50×50505050\times 50 lattice, with the temperature progressively decreasing from left to right. The integrated information ΦΦ\Phi drops to zero bits at T𝑇T\to\infty (leftmost panel) and to one bit as T0𝑇0T\to 0 (rightmost panel), taking a maximum at an intermediate temperature near the phase transition temperature.

We just saw that if two systems are dynamically independent (𝐇3=0subscript𝐇30{\bf H}_{3}=0), then Φ=0Φ0\Phi=0 at all time both for thermal states and for states that were independent (Φ=0Φ0\Phi=0) at some point in time. Let us now consider the opposite extreme. How large can the integrated information ΦΦ\Phi get? A as warmup example, let us consider the familiar 2D Ising model in Figure 2 where n=2500𝑛2500n=2500 magnetic dipoles (or spins) that can point up or down are placed on a square lattice, and 𝐇𝐇{\bf H} is such that they prefer aligning with their nearest neighbors. When T𝑇T\to\infty, ρe𝐇/kT𝐈proportional-to𝜌superscript𝑒𝐇𝑘𝑇𝐈\rho\propto e^{-{\bf H}/kT}\to{\bf I}, so all 2nsuperscript2𝑛2^{n} states are equally likely, all n𝑛n bits are statistically independent, and Φ=0Φ0\Phi=0. When T0𝑇0T\to 0, all states freeze out except the two degenerate ground states (all spin up or all spin down), so all spins are perfectly correlated and Φ=1Φ1\Phi=1 bit. For intermediate temperatures, long-range correlations are seen to exist such that typical states have contiguous spin-up or spin-down patches. On average, we get about one bit of mutual information for each such patch crossing our cut (since a spin on one side “knows” about at a spin on the other side), so for bipartitions that cut the system into two equally large halves, the mutual information will be proportional to the length of the cutting curve. The “cruelest cut” is therefore a vertical or horizontal straight line of length n1/2superscript𝑛12n^{1/2}, giving Φn1/2similar-toΦsuperscript𝑛12\Phi\sim n^{1/2} at the temperature where typical patches are only a few pixels wide. We would similarly get a maximum integration Φn1/3similar-toΦsuperscript𝑛13\Phi\sim n^{1/3} for a 3D Ising system and Φ1similar-toΦ1\Phi\sim 1 bit for a 1D Ising system.

Since it is the spatial correlations that provide the integration, it is interesting to speculate about whether the conscious subsystem of our brain is a system near its critical temperature, close to a phase transition. Indeed, Damasio has argued that to be in homeostasis, a number of physical parameters of our brain need to be kept within a narrow range of values Damasio10 — this is precisely what is required of any condensed matter system to be near-critical, exhibiting correlations that are long-range (providing integration) but not so strong that the whole system becomes correlated like in the right panel or in a brain experiencing an epileptic seizure.

II.4 Integration, coding theory and error correction

Refer to caption

Figure 3: For various 8-bit systems, the integrated information is plotted as a function of the number of bits cut off into a sub-system with the “cruelest cut”. The Hamming (8,4)-code is seen to give classically optimal integration except for a bipartition into 4+4444+4 bits: an arbitrary subset containing no more than three bits is completely determined by the remaining bits. The code consisting of the half of all 8-bit strings whose bit sum is even (i.e., each of the 128 7-bit strings followed by a parity checksum bit) has Hamming distance d=2𝑑2d=2 and gives Φ=1Φ1\Phi=1 however many bits are cut off. A random set of 16 8-bit strings is seen to outperform the Hamming (8,4)-code for 4+4-bipartitions, but not when fewer bits are cut off.

Even when we tuned the temperature to the most favorable value in our 2D Ising model example, the integrated information never exceeded Φn1/2similar-toΦsuperscript𝑛12\Phi\sim n^{1/2} bits, which is merely a fraction n1/2superscript𝑛12n^{-1/2} of the n𝑛n bits of information that n𝑛n spins can potentially store. So can we do better? Fortunately, a closely related question has been carefully studied in the branch of mathematics known as coding theory, with the aim of optimizing error correcting codes. Consider, for example, the following set of m=16𝑚16m=16 bit strings, each written as a column vector of length n=8𝑛8n=8:

M=(00001111000011110000000011111111011010010110100101010101101010100101101001011010001100111100110000111100001111000110011010011001)𝑀00001111000011110000000011111111011010010110100101010101101010100101101001011010001100111100110000111100001111000110011010011001M=\left(\begin{tabular}[]{cccccccccccccccc}0&0&0&0&1&1&1&1&0&0&0&0&1&1&1&1\\ 0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1\\ 0&1&1&0&1&0&0&1&0&1&1&0&1&0&0&1\\ 0&1&0&1&0&1&0&1&1&0&1&0&1&0&1&0\\ 0&1&0&1&1&0&1&0&0&1&0&1&1&0&1&0\\ 0&0&1&1&0&0&1&1&1&1&0&0&1&1&0&0\\ 0&0&1&1&1&1&0&0&0&0&1&1&1&1&0&0\\ 0&1&1&0&0&1&1&0&1&0&0&1&1&0&0&1\\ \end{tabular}\right)

This is known as the Hamming(8,4)-code, and has Hamming distance d=4𝑑4d=4, which means that at least 4 bit flips are required to change one string into another Hamming50 . It is easy to see that for a code with Hamming distance d𝑑d, any (d1)𝑑1(d-1) bits can always be reconstructed from the others: You can always reconstruct b𝑏b bits as long as erasing them does not make two bit strings identical, which would cause ambiguity about which the correct bit string is. This implies that reconstruction works when the Hamming distance d>b𝑑𝑏d>b.

To translate such codes of m𝑚m bit strings of length n𝑛n into physical systems, we simply created a state space with n𝑛n bits (interpretable as n𝑛n spins or other two-state systems) and construct a Hamiltonian which has an m𝑚m-fold degenerate ground state, with one minimum corresponding to each of the m𝑚m bit strings in the code. In the low-temperature limit, all bit strings will receive the same probability weight 1/m1𝑚1/m, giving an entropy S=log2m𝑆subscript2𝑚S=\log_{2}m. The corresponding integrated information ΦΦ\Phi of the ground state is plotted in Figure 3 for a few examples, as a function of cut size k𝑘k (the number of bits assigned to the first subsystem). To calculate ΦΦ\Phi for a cut size k𝑘k in practice, we simply minimize the mutual information I𝐼I over all (nk)FRACOP𝑛𝑘\left({n\atop k}\right) ways of partitioning the n𝑛n bits into k𝑘k and (nk)𝑛𝑘(n-k) bits.

We see that, as advertised, the Hamming(8,4)-code gives gives Φ=3Φ3\Phi=3 when 3 bits are cut off. However, it gives only Φ=2Φ2\Phi=2 for bipartitions; the ΦΦ\Phi-value for bipartitions is not simply related to the Hamming distance, and is not a quantity that most popular bit string codes are optimized for. Indeed, Figure 3 shows that for bipartitions, it underperforms a code consisting of 16 random unique bit strings of the same length. A rich and diverse set of codes have been published in the literature, and the state-of-the-art in terms of maximal Hamming distance for a given n𝑛n is continually updated HammingDistanceSite . Although codes with arbitrarily large Hamming distance d𝑑d exist, there is (just as for our Hamming(8,4)-example above) no guarantee that ΦΦ\Phi will be as large as d1𝑑1d-1 when the smaller of the two subsystems contains more than d𝑑d bits. Moreover, although Reed-Solomon codes are sometimes billed as classically optimal erasure codes (maximizing d𝑑d for a given n𝑛n), their fundamental units are generally not bits but groups of bits (generally numbers modulo some prime number), and the optimality is violated if we make cuts that do not respect the boundaries of these bit groups.

Refer to caption

Figure 4: Same as for previous figure, but for random codes with progressively longer bit strings, consisting of a random subset containing 2nsuperscript2𝑛\sqrt{2^{n}} of the 2nsuperscript2𝑛2^{n} possible bit strings. For better legibility, the vertical axis has been re-centered for the shorter codes.

Although further research on codes maximizing ΦΦ\Phi would be of interest, it is worth noting that simple random codes appear to give ΦΦ\Phi-values within a couple of bits of the theoretical maximum in the limit of large n𝑛n, as illustrated in Figure 4. When cutting off k𝑘k out of n𝑛n bits, the mutual information in classical physics clearly cannot exceed the number of bits in either subsystem, i.e., k𝑘k and nk𝑛𝑘n-k, so the ΦΦ\Phi-curve for a code must lie within the shaded triangle in the figure. (The quantum-mechanical case is more complicated, and we well see in the next section that it in a sense integrates both better and worse.) The codes for which the integrated information is plotted simply consist of a random subset containing 2n/2superscript2𝑛22^{n/2} of the 2nsuperscript2𝑛2^{n} possible bit strings, so roughly speaking, half the bits encode fresh information and the other half provide the redundancy giving near-perfect integration.

Refer to caption

Figure 5: The integrated information is shown for random codes using progressively larger random subsets of the 214superscript2142^{14} possible strings of 14 bits. The optimal choice is seen to be using about 27superscript272^{7} bit strings, i.e., using about half the bits to encode information and the other half to integrate it.

Just as we saw for the Ising model example, these random codes show a tradeoff between entropy and redundancy, as illustrated in Figure 5. When there are n𝑛n bits, how many of the 2nsuperscript2𝑛2^{n} possible bit strings should we use to maximize the integrated information ΦΦ\Phi? If we use m𝑚m of them, we clearly have Φlog2mΦsubscript2𝑚\Phi\leq\log_{2}m, since in classical physics, ΦΦ\Phi cannot exceed the entropy if the system (the mutual information is I=S1+S2S𝐼subscript𝑆1subscript𝑆2𝑆I=S_{1}+S_{2}-S, where S1Ssubscript𝑆1𝑆S_{1}\leq S and S2Ssubscript𝑆2𝑆S_{2}\leq S so IS𝐼𝑆I\leq S). Using very few bit strings is therefore a bad idea. On the other hand, if we use all 2nsuperscript2𝑛2^{n} of them, we lose all redundancy, the bits become independent, and Φ=0Φ0\Phi=0, so being greedy and using too many bit strings in an attempt to store more information is also a bad idea. Figure 5 shows that the optimal tradeoff is to use 2nsuperscript2𝑛\sqrt{2^{n}} of the codewords, i.e., to use half the bits to encode information and the other half to integrate it. Taken together, the last two figures therefore suggest that n𝑛n physical bits can be used to provide about n/2𝑛2n/2 bits of integrated information in the large-n limit.

Refer to caption

Figure 6: A particle in the egg-crate potential energy landscape (top panel) stably encodes 8 bits of information that are completely independent of one another and therefore not integrated. In contrast, a particle in a Hamming(8,4) potential (bottom panel) encodes only 4 bits of information, but with excellent integration. Qualitatively, a hard drive is more like the top panel, while a neural network is more like the bottom panel.

II.5 Integration in physical systems

Let us explore the consequences of these results for physical systems described by a Hamiltonian 𝐇𝐇{\bf H} and a state ρ𝜌\rho. As emphasized by Hopfield Hopfield82 , any physical system with multiple attractors can be viewed as an information storage device, since its state permanently encodes information about which attractor it belongs to. Figure 6 shows two examples of 𝐇𝐇{\bf H} interpretable as potential energy functions for a a single particle in two dimensions. They can both be used as information storage devices, by placing the particle in a potential well and keeping the system cool enough that the particle stays in the same well indefinitely. The egg crate potential V(x,y)=sin2(πx)sin2(πy)𝑉𝑥𝑦superscript2𝜋𝑥superscript2𝜋𝑦V(x,y)=\sin^{2}(\pi x)\sin^{2}(\pi y) (top) has 256 minima and hence a ground state entropy (information storage capacity) S=8𝑆8S=8 bits, whereas the lower potential has only 16 minima and S=4𝑆4S=4 bits.

The basins of attraction in the top panel are seen to be the squares shown in the bottom panel. If we write the xlimit-from𝑥x- and ylimit-from𝑦y- coordinates as binary numbers with b𝑏b bits each, then the first 4 bits of x𝑥x and y𝑦y encode which square (x,y)𝑥𝑦(x,y) is in. The information in the remaining bits encodes the location within this square; these bits are not useful for information storage because they can vary over time, as the particle oscillates around a minimum. If the system is actively cooled, these oscillations are gradually damped out and the particle settles toward the attractor solution at the minimum, at the center of its basin. This example illustrates that cooling is a physical example of error correction: if thermal noise adds small perturbations to the particle position, altering the least significant bits, then cooling will remove these perturbations and push the particle back towards the minimum it came from. As long as cooling keeps the perturbations small enough that the particle never rolls out of its basin of attraction, all the 8 bits of information encoding its basin number are perfectly preserved. Instead of interpreting our n=8𝑛8n=8 data bits as positions in two dimensions, we can interpret them as positions in n𝑛n dimensions, where each possible state corresponds to a corner of the n𝑛n-dimensional hypercube. This captures the essence of many computer memory devices, where each bit is stored in a system with two degenerate minima; the least significant and redundant bits that can be error-corrected via cooling now get equally distributed among all the dimensions.

How integrated is the information S𝑆S? For the top panel of Figure 6, not at all: 𝐇𝐇{\bf H} can be factored as a tensor product of 888 two-state systems, so Φ=0Φ0\Phi=0, just as for typical computer memory. In other words, if the particle is in a particular egg crate basin, knowing any one of the bits specifying the basin position tells us nothing about the other bits. The potential in the lower panel, on the other hand, gives good integration. This potential retains only 16 of the 256 minima, corresponding to the 16 bit strings of the Hamming(8,4)-code, which as we saw gives Φ=3Φ3\Phi=3 for any 3 bits cut off and Φ=2Φ2\Phi=2 bits for symmetric bipartitions. Since the Hamming distance d=4𝑑4d=4 for this code, at least 4 bits must be flipped to reach another minimum, which among other things implies that no two basins can share a row or column.

II.6 The pros and cons of integration

Natural selection suggests that self-reproducing information-processing systems will evolve integration if it is useful to them, regardless of whether they are conscious or not. Error correction can obviously be useful, both to correct errors caused by thermal noise and to provide redundancy that improves robustness toward failure of individual physical components such as neurons. Indeed, such utility explains the preponderance of error correction built into human-developed devices, from RAID-storage to bar codes to forward error correction in telecommunications. If Tononi is correct and consciousness requires integration, then this raises an interesting possibility: our human consciousness may have evolved as an accidental by-product of error correction. There is also empirical evidence that integration is useful for problem-solving: artificial life simulations of vehicles that have to traverse mazes and whose brains evolve by natural selection show that the more adapted they are to their environment, the higher the integrated information of the main complex in their brain Joshi13 .

However, integration comes at a cost, and as we will now see, near maximal integration appears to be prohibitively expensive. Let us distinguish between the maximum amount of information that can be stored in a state defined by ρ𝜌\rho and the maximum amount of information that can be stored in a physical system defined by 𝐇𝐇{\bf H}. The former is simply S(ρ)𝑆𝜌S(\rho) for the perfectly mixed (𝐓=𝐓{\bf T}=\infty) state, i.e., log2subscript2\log_{2} of the number of possible states (the number of bits characterizing the system). The latter can be much larger, corresponding to log2subscript2\log_{2} of the number of Hamiltonians that you could distinguish between given your time and energy available for experimentation. Let us consider potential energy functions whose k𝑘k different minima can be encoded as bit strings (as in Figure 6), and let us limit our experimentation to finding all the minima. Then 𝐇𝐇{\bf H} encodes not a single string of n𝑛n bits, but a subset consisting of k𝑘k out of all 2nsuperscript2𝑛2^{n} such strings, one for each minimum. There are (2nk)FRACOPsuperscript2𝑛𝑘\left({2^{n}\atop k}\right) such subsets, so the information contained in 𝐇𝐇{\bf H} is

S(𝐇)𝑆𝐇\displaystyle S({\bf H}) =\displaystyle= log2(2nk)=log22n!k!(2nk)!subscript2FRACOPsuperscript2𝑛𝑘subscript2superscript2𝑛𝑘superscript2𝑛𝑘absent\displaystyle\log_{2}\left({2^{n}\atop k}\right)=\log_{2}{2^{n}!\over k!(2^{n}-k)!}\approx (7)
\displaystyle\approx log2(2n)kkk=k(nlog2k)subscript2superscriptsuperscript2𝑛𝑘superscript𝑘𝑘𝑘𝑛subscript2𝑘\displaystyle\log_{2}{(2^{n})^{k}\over k^{k}}=k(n-\log_{2}k)

for k2nmuch-less-than𝑘superscript2𝑛k\ll 2^{n}, where we used Stirling’s approximation k!kk𝑘superscript𝑘𝑘k!\approx k^{k}. So crudely speaking, 𝐇𝐇{\bf H} encodes not n𝑛n bits but kn𝑘𝑛kn bits. For the near-maximal integration given by the random codes from the previous section, we had k=2n/2𝑘superscript2𝑛2k=2^{n/2}, which gives S(𝐇)2n/2n2similar-to𝑆𝐇superscript2𝑛2𝑛2S({\bf H})\sim 2^{n/2}\>{n\over 2} bits. For example, if the n1011similar-to𝑛superscript1011n\sim 10^{11} neurons in your brain were maximally integrated in this way, then your neural network would require a dizzying 1010000000000superscript101000000000010^{10000000000} bits to describe, vastly more information than can be encoded by all the 1089superscript108910^{89} particles in our universe combined.

The neuronal mechanisms of human memory are still unclear despite intensive experimental and theoretical explorations Barak13 , but there is significant evidence that the brain uses attractor dynamics in its integration and memory functions, where discrete attractors may be used to represent discrete items Yoon13 . The classic implementation of such dynamics as a simple symmetric and asynchronous Hopfield neural network Hopfield82 can be conveniently interpreted in terms of potential energy functions: the equations of the continuous Hopfield network are identical to a set of mean-field equations that minimize a potential energy function, so this network always converges to a basin of attraction McKayBook . Such a Hopfield network gives a dramatically lower information content S(𝐇)𝑆𝐇S({\bf H}) of only about 0.25 bits per synapseMcKayBook , and we have only about 1014superscript101410^{14} synapses, suggesting that our brains can store only on the order of a few Terabytes of information.

The integrated information of a Hopfield network is even lower. For a Hopfield network of n𝑛n neurons with Hebbian learning, the total number of attractors is bounded by 0.14n0.14𝑛0.14n McKayBook , so the maximum information capacity is merely Slog20.14nlog2n37𝑆subscript20.14𝑛subscript2𝑛37S\approx\log_{2}0.14n\approx\log_{2}n\approx 37 bits for n=1011𝑛superscript1011n=10^{11} neurons. Even in the most favorable case where these bits are maximally integrated, our 1011superscript101110^{11} neurons thus provide a measly Φ37Φ37\Phi\approx 37 bits of integrated information, as opposed to about Φ5×1010Φ5superscript1010\Phi\approx 5\times 10^{10} bits for a random coding.

II.7 The integration paradox

This leaves us with an integration paradox: why does the information content of our conscious experience appear to be vastly larger than 37 bits? If Tononi’s information and integration principles from Section I are correct, the integration paradox forces us666Can we sidestep the integration paradox by simply dismissing the idea that integration is necessary? Although it remains controversial whether integrated information is a sufficient condition for consciousness as asserted by IIT, it appears rather obvious that it is a necessary condition if the conscious experience is unified: if there were no integration, the conscious mind would consist of two separate parts that were independent of one another and hence unaware of each other. to draw at least one of the following three conclusions:

  1. 1.

    Our brains use some more clever scheme for encoding our conscious bits of information, which allows dramatically larger ΦΦ\Phi than Hebbian Hopfield networks.

  2. 2.

    These conscious bits are much fewer than we might naively have thought from introspection, implying that we are only able to pay attention to a very modest amount of information at any instant.

  3. 3.

    To be relevant for consciousness, the definition of integrated information that we have used must be modified or supplemented by at least one additional principle.

We will see that the quantum results in the next section bolster the case for conclusion 3. Interestingly, there is also support for conclusion 2 in the large psychophysical literature on the illusion of the perceptual richness of the world. For example, there is evidence suggesting that of the roughly 107superscript10710^{7} bits of information that enter our brain each second from our sensory organs, we can only be aware of a tiny fraction, with estimates ranging from 10 to 50 bits Kupfmuller62 ; NorretrandersBook .

The fundamental reason why a Hopfield network is specified by much less information than a near-maximally integrated network is that it involves only pairwise couplings between neurons, thus requiring only n2similar-toabsentsuperscript𝑛2\sim n^{2} coupling parameters to be specified — as opposed to 2nsuperscript2𝑛2^{n} parameters giving the energy for each of the 2nsuperscript2𝑛2^{n} possible states. It is striking how 𝐇𝐇{\bf H} is similarly simple for the standard model of particle physics, with the energy involving only sums of pairwise interactions between particles supplemented with occasional 3-way and 4-way couplings. 𝐇𝐇{\bf H} for the brain and 𝐇𝐇{\bf H} for fundamental physics thus both appear to belong to an extremely simple sub-class of all Hamiltonians, that require an unusually small amount of information to describe. Just as a system implementing near-maximal integration via random coding is too complicated to fit inside the brain, it is also too complicated to work in fundamental physics: Since the information storage capacity S𝑆S of a physical system is approximately bounded by its number of particles Lloyd99 or by its area in Planck units by the Holographic principle tHooft93 , it cannot be integrated by physical dynamics that itself requires storage of the exponentially larger information quantity S(H)2S/2S2similar-to𝑆𝐻superscript2𝑆2𝑆2S(H)\sim 2^{S/2}\>{S\over 2} unless the Standard Model Hamiltonian is replaced by something dramatically more complicated.

An interesting theoretical direction for further research (pursuing resolution 1 to the integration paradox) is therefore to investigate what maximum amount of integrated information ΦΦ\Phi can be feasibly stored in a physical system using codes that are algorithmic (such as RS-codes) rather than random. An interesting experimental direction would be to search for concrete implementations of error-correction algorithms in the brain.

In summary, we have explored the integration principle by quantifying integrated information in physical systems. We have found that although excellent integration is possible in principle, it is more difficult in practice. In theory, random codes provide nearly maximal integration, with about half of all n𝑛n bits coding for data and the other half providing ΨnΨ𝑛\Psi\approx n bits of integration), but in practice, the dynamics required for implementing them is too complex for our brain or our universe. Most of our exploration has focused on classical physics, where cuts into subsystems have corresponded to partitions of classical bits. As we will see in the next section, finding systems encoding large amounts of integrated information is even more challenging when we turn to the quantum-mechanical case.

III Independence

III.1 Classical versus quantum independence

Refer to caption

Figure 7: Mutual information versus entropy for various 2-bit systems. The different dots, squares and stars correspond to different states, which in the classical cases are defined by the probabilities for the four basis states 00, 01 10 and 11. Classical states can lie only in the pyramid below the upper black star with (S,I)=(1,1)𝑆𝐼11(S,I)=(1,1), whereas entanglement allows quantum states to extend all the way up to the upper black square at (0,2)02(0,2). However, the integrated information ΦΦ\Phi for a quantum state cannot lie above the shaded green/grey region, into which any other quantum state can be brought by a unitary transformation. Along the upper boundary of this region, either three of the four probabilities are equal, or to two of them are equal while one vanishes.

How cruel is what Tononi calls “the cruelest cut”, dividing a system into two parts that are maximally independent? The situation is quite different in classical physics and quantum physics, as Figure 7 illustrates for a simple 2-bit system. In classical physics, the state is specified by a 2×2222\times 2 matrix giving the probabilities for the four states 00, 01, 10 and 11, which define an entropy S𝑆S and mutual information I𝐼I. Since there is only one possible cut, the integrated information Φ=IΦ𝐼\Phi=I. The point defined by the pair (S,Φ)𝑆Φ(S,\Phi) can lie anywhere in the “pyramid” in the figure, who’s top at (S,Φ)=(1,1)𝑆Φ11(S,\Phi)=(1,1) (black star) gives maximum integration, and corresponds to perfect correlation between the two bits: 50% probability for 00 and 11. Perfect anti-correlation gives the same point. The other two vertices of the classically allowed region are seen to be (S,Φ)=(0,0)𝑆Φ00(S,\Phi)=(0,0) (100% probability for a single outcome) and (S,Φ)=(2,0)𝑆Φ20(S,\Phi)=(2,0) (equal probability for all four outcomes).

In quantum mechanics, where the 2-qubit state is defined by a 4×4444\times 4 density matrix, the available area in the (S,I)𝑆𝐼(S,I)-plane doubles to include the entire shaded triangle, with the classically unattainable region opened up because of entanglement. The extreme case is a Bell pair state such as

|ψ=12(||+||),ket𝜓12ketketketket|\psi\rangle={1\over\sqrt{2}}\left(|\!\!\uparrow\rangle|\!\!\uparrow\rangle+|\!\!\downarrow\rangle|\!\!\downarrow\rangle\right), (8)

which gives (S,I)=(0,2)𝑆𝐼02(S,I)=(0,2). However, whereas there was only one possible cut for 2 classical bits, there are now infinitely many possible cuts because in quantum mechanics, all Hilbert space bases are equally valid, and we can choose to perform the factorization in any of them. Since ΦΦ\Phi is defined as I𝐼I after the cruelest cut, it is the I𝐼I-value minimized over all possible factorizations. For simplicity, we use the notation where tensor-product\otimes denotes factorization in the coordinate basis, so the integrated information is

Φ=min𝐔I(𝐔ρ𝐔),Φsubscript𝐔𝐼𝐔𝜌superscript𝐔\Phi=\min_{\bf U}\>I({\bf U}\rho{\bf U}^{\dagger}), (9)

i.e., the mutual information minimized over all possible unitary transformations 𝐔𝐔{\bf U}. Since the Bell pair of equation (8) is a pure state ρ=|ψψ|𝜌ket𝜓bra𝜓\rho=|\psi\rangle\langle\psi|, we can unitarily transform it into a basis where the first basis vector is |ψket𝜓|\psi\rangle, making it factorizable:

𝐔(12001200000000120012)𝐔=(1000000000000000)=(1000)(1000).𝐔12001200000000120012superscript𝐔fragments1000000000000000tensor-product10001000{\bf U}\left(\begin{tabular}[]{cccc}${1\over 2}$&$0$&$0$&${1\over 2}$\\ $0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\\ ${1\over 2}$&$0$&$0$&${1\over 2}$\end{tabular}\right){\bf U}^{\dagger}=\left(\begin{tabular}[]{cccc}$1$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\end{tabular}\right)=\left(\begin{tabular}[]{cccc}$1$&$0$\\ $0$&$0$\end{tabular}\right)\otimes\left(\begin{tabular}[]{cccc}$1$&$0$\\ $0$&$0$\end{tabular}\right). (10)

This means that Φ=0Φ0\Phi=0, so in quantum mechanics, the cruelest cut can be very cruel indeed: the most entangled states possible in quantum mechanics have no integrated information at all!

The same cruel fate awaits the most integrated 2-bit state from classical physics: the perfectly correlated mixed state ρ=12||+12||\rho={1\over 2}|\!\!\uparrow\rangle\langle\uparrow\!\!|+{1\over 2}|\!\!\downarrow\rangle\langle\downarrow\!\!|. It gave Φ=1Φ1\Phi=1 bit classically above (upper black star in the figure), but a unitary transformation permuting its diagonal elements makes it factorable:

𝐔(120000000000000012)𝐔=(120000120000000000)=(1000)(120012),𝐔120000000000000012superscript𝐔120000120000000000tensor-product1000120012{\bf U}\left(\begin{tabular}[]{cccc}${1\over 2}$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\\ $0$&$0$&$0$&${1\over 2}$\end{tabular}\right){\bf U}^{\dagger}=\left(\begin{tabular}[]{cccc}${1\over 2}$&$0$&$0$&$0$\\ $0$&${1\over 2}$&$0$&$0$\\ $0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$\end{tabular}\right)=\left(\begin{tabular}[]{cccc}$1$&$0$\\ $0$&$0$\end{tabular}\right)\otimes\left(\begin{tabular}[]{cccc}${1\over 2}$&$0$\\ $0$&${1\over 2}$\end{tabular}\right), (11)

so Φ=0Φ0\Phi=0 quantum-mechanically (lower black star in the figure).

III.2 Canonical transformations, independence and relativity

The fundamental reason that these states are more separable quantum-mechanically is clearly that more cuts are available, making the cruelest one crueler. Interestingly, the same thing can happen also in classical physics. Consider, for example, our example of the deuterium atom from equation (1). When we restricted our cuts to simply separating different degrees of freedom, we found that the group (𝐫p,𝐩p,𝐫n,𝐩n)subscript𝐫𝑝subscript𝐩𝑝subscript𝐫𝑛subscript𝐩𝑛({\bf r}_{p},{\bf p}_{p},{\bf r}_{n},{\bf p}_{n}) was quite (but not completely) independent of the group (𝐫e,𝐩e)subscript𝐫𝑒subscript𝐩𝑒({\bf r}_{e},{\bf p}_{e}), and that there was no cut splitting things into perfectly independent pieces. In other words, the nucleus was fairly independent of the electron, but none of the three particles was completely independent of the other two. However, if we allow our degrees of freedom to be transformed before the cut, then things can be split into two perfectly independent parts! The classical equivalent of a unitary transformation is of course a canonical transformation (one that preserves phase-space volume). If we perform the canonical transformation where the new coordinates are the center-of-mass position 𝐫Msubscript𝐫𝑀{\bf r}_{M} and the relative displacements 𝐫p𝐫p𝐫Msuperscriptsubscript𝐫𝑝subscript𝐫𝑝subscript𝐫𝑀{\bf r}_{p}^{\prime}\equiv{\bf r}_{p}-{\bf r}_{M} and 𝐫e𝐫e𝐫Msuperscriptsubscript𝐫𝑒subscript𝐫𝑒subscript𝐫𝑀{\bf r}_{e}^{\prime}\equiv{\bf r}_{e}-{\bf r}_{M}, and correspondingly define 𝐩Msubscript𝐩𝑀{\bf p}_{M} as the total momentum of the whole system, etc., then we find that (𝐫M,𝐩M)subscript𝐫𝑀subscript𝐩𝑀({\bf r}_{M},{\bf p}_{M}) is completely independent of the rest. In other words, the average motion of the entire deuterium atom is completely decoupled from the internal motions around its center-of-mass.

Interestingly, this well-known possibility of decomposing any isolated system into average and relative motions (the “average-relative decomposition”, for short) is equivalent to relativity theory in the following sense. The core of relativity theory is that all laws of physics (including the speed of light) are the same in all inertial frames. This implies the average-relative decomposition, since the laws of physics governing the relative motions of the system are the same in all inertial frames and hence independent of the (uniform) center-of-mass motion. Conversely, we can view relativity as a special case of the average-relative decomposition. If two systems are completely independent, then they can gain no knowledge of each other, so a conscious observer in one will be unaware of the other. The average-relative decomposition therefore implies that an observer in an isolated system has no way of knowing whether she is at rest or in uniform motion, because these are simply two different allowed states for the center-of-mass subsystem, which is completely independent from (and hence inaccessible to) the internal-motions subsystem of which her consciousness is a part.

III.3 How integrated can quantum states be?

We saw in Figure 7 that some seemingly integrated states, such as a Bell pair or a pair of classically perfectly correlated bits, are in fact not integrated at all. But the figure also shows that some states are truly integrated even quantum-mechanically, with I>0𝐼0I>0 even for the cruelest cut. How integrated can a quantum state be? The following theorem, proved by Jevtic, Jennings & Rudolph Jevtic11 , enables the answer to be straightforwardly calculated777The converse of the ρ𝜌\rhoDC is straightforward to prove: if Φ=0Φ0\Phi=0 (which is equivalent to the state being factorizable; ρ=ρ1ρ2𝜌tensor-productsubscript𝜌1subscript𝜌2\rho=\rho_{1}\otimes\rho_{2}), then it is factorizable also in its eigenbasis where both ρ1subscript𝜌1\rho_{1} and ρ2subscript𝜌2\rho_{2} are diagonal.:

ρ𝜌\rho-Diagonality Theorem (ρ𝜌\rhoDC):
The mutual information always takes its minimum in a basis where ρ𝜌\rho is diagonal

The first step in computing the integrated information Φ(ρ)Φ𝜌\Phi(\rho) is thus to diagonalize the n×n𝑛𝑛n\times n density matrix ρ𝜌\rho. If all n𝑛n eigenvalues are different, then there are n!𝑛n! possible ways of doing this, corresponding to the n!𝑛n! ways of permuting the eigenvalues, so the ρ𝜌\rhoDC simplifies the continuous minimization problem of equation (9) to a discrete minimization problem over these n!𝑛n! permutations. Suppose that n=l×m𝑛𝑙𝑚n=l\times m, and that we wish to factor the n𝑛n-dimensional Hilbert space into factor spaces of dimensionality l𝑙l and m𝑚m, so that Φ=0Φ0\Phi=0. It is easy to see that this is possible if the n𝑛n eigenvalues of ρ𝜌\rho can be arranged into an l×m𝑙𝑚l\times m matrix that is multiplicatively separable (rank 1), i.e., the product of a column vector and a row vector. Extracting the eigenvalues for our example from equation (11) where l=m=2𝑙𝑚2l=m=2 and n=4𝑛4n=4, we see that

(121200) is separable, but(120012) is not,121200 is separable, but120012 is not\left(\begin{tabular}[]{cc}${1\over 2}$&${1\over 2}$\\ $0$&$0$\end{tabular}\right)\hbox{ is separable, but}\quad\left(\begin{tabular}[]{cc}${1\over 2}$&$0$\\ $0$&${1\over 2}$\end{tabular}\right)\hbox{ is not},

and that the only difference is that the order of the four numbers has been permuted. More generally, we see that to find the “cruelest cut” that defines the integrated information ΦΦ\Phi, we want to find the permutation that makes the matrix of eigenvalues as separable as possible. It is easy to see that when seeking the permutation giving maximum separability, we can without loss of generality place the largest eigenvalue first (in the upper left corner) and the smallest one last (in the lower right corner). If there are only 4 eigenvalues (as in the above example), the ordering of the remaining two has no effect on I𝐼I.

III.4 The quantum integration paradox

We now have the tools in hand to answer the key question from the last section: which state ρ𝜌\rho maximizes the integrated information ΦΦ\Phi? Numerical search suggests that the most integrated state is a rescaled projection matrix satisfying ρ2ρproportional-tosuperscript𝜌2𝜌\rho^{2}\propto\rho. This means that some number k𝑘k of the n𝑛n eigenvalues equal 1/k1𝑘1/k and the remaining ones vanish.888A heuristic way of understanding why having many equal eigenvalues is advantageous is that it helps eliminate the effect of the eigenvalue permutations that we are minimizing over. If the optimal state has two distinct eigenvalues, then if swapping them changes I𝐼I, it must by definition increase I𝐼I by some finite amount. This suggests that we can increase the integration ΦΦ\Phi by bringing the eigenvalues infinitesimally closer or further apart, and repeating this procedure lets us further increase ΦΦ\Phi until all eigenvalues are either zero or equal to the same positive constant. For the n=4𝑛4n=4 example from Figure 7, k=3𝑘3k=3 is seen to give the best integration, with eigenvalues (probabilities) 1/3131/3, 1/3131/3, 1/3131/3 and 00, giving Φ=log(27/16)/log(8)0.2516Φ271680.2516\Phi=\log(27/16)/\log(8)\approx 0.2516.

For classical physics, we saw that the maximal attainable ΦΦ\Phi grows roughly linearly with n𝑛n. Quantum-mechanically, however, it decreases as n𝑛n increases!999One finds that ΦΦ\Phi is maximized when the k𝑘k identical nonzero eigenvalues are arranged in a Young Tableau, which corresponds to a partition of k𝑘k as a sum of positive integers k1+k2+subscript𝑘1subscript𝑘2k_{1}+k_{2}+..., giving Φ=S(𝐩)+S(𝐩)log2kΦ𝑆𝐩𝑆superscript𝐩subscript2𝑘\Phi=S({\bf p})+S({\bf p}^{*})-\log_{2}k, where the probability vectors 𝐩𝐩{\bf p} and 𝐩superscript𝐩{\bf p}^{*} are defined by pi=ki/ksubscript𝑝𝑖subscript𝑘𝑖𝑘p_{i}=k_{i}/k and pi=ki/ksubscriptsuperscript𝑝𝑖superscriptsubscript𝑘𝑖𝑘p^{*}_{i}=k_{i}^{*}/k. Here kisuperscriptsubscript𝑘𝑖k_{i}^{*} denotes the conjugate partition. For example, if we cut an even number of qubits into two parts with n/2𝑛2n/2 qubits each, then n=2,4,6,,20𝑛24620n=2,4,6,...,20 gives Φ0.252,0.171,0.128,0.085,0.085,0.073,0.056,0.056,0.051Φ0.2520.1710.1280.0850.0850.0730.0560.0560.051\Phi\approx 0.252,0.171,0.128,0.085,0.085,0.073,0.056,0.056,0.051 and 0.0420.0420.042 bits, respectively.

In summary, no matter how large a quantum system we create, its state can never contain more than about a quarter of a bit of integrated information! This exacerbates the integration paradox from Section II.7, eliminating both of the first two resolutions: you are clearly aware of more than 0.250.250.25 bits of information right now, and this quarter-bit maximum applies not merely to states of Hopfield networks, but to any quantum states of any system. Let us therefore begin exploring the third resolution: that our definition of integrated information must be modified or supplemented by at least one additional principle.

III.5 How integrated is the Hamiltonian?

An obvious way to begin this exploration is to consider the state ρ𝜌\rho not merely at a single fixed time t𝑡t, but as a function of time. After all, it is widely assumed that consciousness is related to information processing, not mere information storage. Indeed, Tononi’s original ΦΦ\Phi-definition TononiManifesto (which applies to classical neural networks rather than general quantum systems) involves time, depending on the extent to which current events affect future ones.

Because the time-evolution of the state ρ𝜌\rho is determined by the Hamiltonian 𝐇𝐇{\bf H} via the Schrödinger equation

ρ˙=i[𝐇,ρ],˙𝜌𝑖𝐇𝜌\dot{\rho}=i[{\bf H},\rho], (12)

whose solution is

ρ(t)=ei𝐇tρei𝐇t,𝜌𝑡superscript𝑒𝑖𝐇𝑡𝜌superscript𝑒𝑖𝐇𝑡\rho(t)=e^{i{\bf H}t}\rho e^{-i{\bf H}t}, (13)

we need to investigate the extent to which the cruelest cut can decompose not merely ρ𝜌\rho but the pair (ρ,H)𝜌𝐻(\rho,H) into independent parts. (Here and throughout, we often use units where =1Planck-constant-over-2-pi1\hbar=1 for simplicity.)

III.6 Evolution with separable Hamiltonian

As we saw above, the key question for ρ𝜌\rho is whether it it is factorizable (expressible as product ρ=ρ1ρ2𝜌tensor-productsubscript𝜌1subscript𝜌2\rho=\rho_{1}\otimes\rho_{2} of matrices acting on the two subsystems), whereas the key question for 𝐇𝐇{\bf H} is whether it is what we will call additively separable, being a sum of matrices acting on the two subsystems, i.e., expressible in the form

𝐇=𝐇1𝐈+𝐈𝐇2𝐇tensor-productsubscript𝐇1𝐈tensor-product𝐈subscript𝐇2{\bf H}={\bf H}_{1}\otimes{\bf I}+{\bf I}\otimes{\bf H}_{2} (14)

for some matrices 𝐇1subscript𝐇1{\bf H}_{1} and 𝐇2subscript𝐇2{\bf H}_{2}. For brevity, we will often write simply separable instead of additively separable. As mentioned in Section II.2, a separable Hamiltonian 𝐇𝐇{\bf H} implies that both the thermal state ρe𝐇/kTproportional-to𝜌superscript𝑒𝐇𝑘𝑇\rho\propto e^{-{\bf H}/kT} and the time-evolution operator 𝐔ei𝐇t/𝐔superscript𝑒𝑖𝐇𝑡Planck-constant-over-2-pi{\bf U}\equiv e^{i{\bf H}t/\hbar} are factorizable. An important property of density matrices which was pointed out already by von Neumann when he invented them vonNeumann32 is that if 𝐇𝐇{\bf H} is separable, then

ρ˙1=i[𝐇1,ρ1],subscript˙𝜌1𝑖subscript𝐇1subscript𝜌1\dot{\rho}_{1}=i[{\bf H}_{1},\rho_{1}], (15)

i.e., the time-evolution of the state of the first subsystem, ρ1tr2ρsubscript𝜌1subscripttr2𝜌\rho_{1}\equiv\hbox{tr}\,_{2}\rho, is independent of the other subsystem and of any entanglement with it that may exist. This is easy to prove: Using the identities (151) and (153) shows that

tr2[𝐇1𝐈,ρ]subscripttr2tensor-productsubscript𝐇1𝐈𝜌\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf H}_{1}\otimes{\bf I},\rho] =\displaystyle= tr2{(𝐇1𝐈)ρ}tr2{ρ(𝐇1𝐈)}subscripttr2tensor-productsubscript𝐇1𝐈𝜌subscripttr2𝜌tensor-productsubscript𝐇1𝐈\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}\{({\bf H}_{1}\otimes{\bf I})\rho\}-\operatornamewithlimits{\hbox{tr}\,}_{2}\{\rho({\bf H}_{1}\otimes{\bf I})\} (16)
=\displaystyle= 𝐇1ρ1ρ1𝐇2=[𝐇1,ρ1].subscript𝐇1subscript𝜌1subscript𝜌1subscript𝐇2subscript𝐇1subscript𝜌1\displaystyle{\bf H}_{1}\rho_{1}-\rho_{1}{\bf H}_{2}=[{\bf H}_{1},\rho_{1}].

Using the identity (149) shows that

tr2[𝐈𝐇2,ρ]=0.subscripttr2tensor-product𝐈subscript𝐇2𝜌0\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf I}\otimes{\bf H}_{2},\rho]=0. (17)

Summing equations (16) and (17) completes the proof.

III.7 The cruelest cut as the maximization of separability

Since a general Hamiltonian 𝐇𝐇{\bf H} cannot be written in the separable form of equation (14), it will also include a third term 𝐇3subscript𝐇3{\bf H}_{3} that is non-separable. The independence principle from Section I therefore suggests an interesting mathematical approach to the physics-from-scratch problem of analyzing the total Hamiltonian 𝐇𝐇{\bf H} for our physical world:

  1. 1.

    Find the Hilbert space factorization giving the “cruelest cut”, decomposing 𝐇𝐇{\bf H} into parts with the smallest interaction Hamiltonian 𝐇3subscript𝐇3{\bf H}_{3} possible.

  2. 2.

    Keep repeating this subdivision procedure for each part until only relatively integrated parts remain that cannot be further decomposed with a small interaction Hamiltonian.

The hope would be that applying this procedure to the Hamiltonian of our standard model would reproduce the full observed object hierarchy from Figure 1, with the factorization corresponding to the objects, and the various non-separable terms 𝐇3subscript𝐇3{\bf H}_{3} describing the interactions between these objects. Any decomposition with 𝐇3=0subscript𝐇30{\bf H}_{3}=0 would correspond to two parallel universes unable to communicate with one another.

We will now formulate this as a rigorous mathematics problem, solve it, and derive the observational consequences. We will find that this approach fails catastrophically when confronted with observation, giving interesting hints regarding further physical principles needed for understanding why we perceive our world as an object hierarchy.

III.8 The Hilbert-Schmidt vector space

To enable a rigorous formulation of our problem, let us first briefly review the Hilbert-Schmidt vector space, a convenient inner-product space where the vectors are not wave functions |ψket𝜓|\psi\rangle but matrices such as 𝐇𝐇{\bf H} and ρ𝜌\rho. For any two matrices 𝐀𝐀{\bf A} and 𝐁𝐁{\bf B}, the Hilbert-Schmidt inner product is defined by

(𝐀,𝐁)tr𝐀𝐁.𝐀𝐁trsuperscript𝐀𝐁({\bf A},{\bf B})\equiv\hbox{tr}\,{\bf A}^{\dagger}{\bf B}. (18)

For example, the trace operator can be written as an inner product with the identity matrix:

tr𝐀=(𝐈,𝐀).tr𝐀𝐈𝐀\hbox{tr}\,{\bf A}=({\bf I},{\bf A}). (19)

This inner product defines the Hilbert-Schmidt norm (also known as the Frobenius norm)

𝐀(𝐀,𝐀)12=(tr𝐀𝐀)12=(ij|Aij|2)12.norm𝐀superscript𝐀𝐀12superscripttrsuperscript𝐀𝐀12superscriptsubscript𝑖𝑗superscriptsubscript𝐴𝑖𝑗212||{\bf A}||\equiv({\bf A},{\bf A})^{1\over 2}=(\hbox{tr}\,{\bf A}^{\dagger}{\bf A})^{1\over 2}=\left(\sum_{ij}|A_{ij}|^{2}\right)^{1\over 2}. (20)

If 𝐀𝐀{\bf A} is Hermitian (𝐀=𝐀superscript𝐀𝐀{\bf A}^{\dagger}={\bf A}), then 𝐀2superscriptnorm𝐀2||{\bf A}||^{2} is simply the sum of the squares of its eigenvalues.

Real symmetric and antisymmetric matrices form orthogonal subspaces under the Hilbert-Schmidt inner product, since (𝐒,𝐀)=0𝐒𝐀0({\bf S},{\bf A})=0 for any symmetric matrix 𝐒𝐒{\bf S} (satisfying 𝐒t=𝐒){\bf S}^{t}={\bf S}) and any antisymmetric matrix 𝐀𝐀{\bf A} (satisfying 𝐀t=𝐀superscript𝐀𝑡𝐀{\bf A}^{t}=-{\bf A}). Because a Hermitian matrix (satisfying 𝐇=𝐇superscript𝐇𝐇{\bf H}^{\dagger}={\bf H}) can be written in terms of real symmetric and antisymmetric matrices as 𝐇=𝐒+i𝐀𝐇𝐒𝑖𝐀{\bf H}={\bf S}+i{\bf A}, we have

(𝐇1,𝐇2)=(𝐒1,𝐒2)+(𝐀1,𝐀2),subscript𝐇1subscript𝐇2subscript𝐒1subscript𝐒2subscript𝐀1subscript𝐀2({\bf H}_{1},{\bf H}_{2})=({\bf S}_{1},{\bf S}_{2})+({\bf A}_{1},{\bf A}_{2}),

which means that the inner product of two Hermitian matrices is purely real.

III.9 Separating 𝐇𝐇{\bf H} with orthogonal projectors

By viewing 𝐇𝐇{\bf H} as a vector in the Hilbert-Schmidt vector space, we can rigorously define an decomposition of it into orthogonal components, two of which are the separable terms from equation (14). Given a factorization of the Hilbert space where the matrix 𝐇𝐇{\bf H} operates, we define four linear superoperators101010Operators on the Hilbert-Schmidt space are usually called superoperators in the literature, to avoid confusions with operators on the underlying Hilbert space, which are mere vectors in the Hilbert-Schmidt space. 𝚷isubscript𝚷𝑖{\mathbf{\Pi}}_{i} as follows:

𝚷0𝐇subscript𝚷0𝐇\displaystyle{\mathbf{\Pi}}_{0}{\bf H} \displaystyle\equiv 1n(tr𝐇)𝐈1𝑛tr𝐇𝐈\displaystyle{1\over n}(\hbox{tr}\,{\bf H})\>{\bf I} (21)
𝚷1𝐇subscript𝚷1𝐇\displaystyle{\mathbf{\Pi}}_{1}{\bf H} \displaystyle\equiv (1n2tr2𝐇)𝐈2𝚷0𝐇tensor-product1subscript𝑛2subscripttr2𝐇subscript𝐈2subscript𝚷0𝐇\displaystyle\left({1\over n_{2}}\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf H}\right)\otimes{\bf I}_{2}-{\mathbf{\Pi}}_{0}{\bf H} (22)
𝚷2𝐇subscript𝚷2𝐇\displaystyle{\mathbf{\Pi}}_{2}{\bf H} \displaystyle\equiv 𝐈1(1n1tr1𝐇)𝚷0𝐇tensor-productsubscript𝐈11subscript𝑛1subscripttr1𝐇subscript𝚷0𝐇\displaystyle{\bf I}_{1}\otimes\left({1\over n_{1}}\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf H}\right)-{\mathbf{\Pi}}_{0}{\bf H} (23)
𝚷3𝐇subscript𝚷3𝐇\displaystyle{\mathbf{\Pi}}_{3}{\bf H} \displaystyle\equiv (𝐈𝚷1𝚷2𝚷3)𝐇𝐈subscript𝚷1subscript𝚷2subscript𝚷3𝐇\displaystyle({\bf I}-{\mathbf{\Pi}}_{1}-{\mathbf{\Pi}}_{2}-{\mathbf{\Pi}}_{3}){\bf H} (24)

It is straightforward to show that these four linear operators 𝚷isubscript𝚷𝑖{\mathbf{\Pi}}_{i} form a complete set of orthogonal projectors, i.e., that

i=03𝚷isuperscriptsubscript𝑖03subscript𝚷𝑖\displaystyle\sum_{i=0}^{3}{\mathbf{\Pi}}_{i} =\displaystyle= 𝐈,𝐈\displaystyle{\bf I}, (25)
𝚷i𝚷jsubscript𝚷𝑖subscript𝚷𝑗\displaystyle{\mathbf{\Pi}}_{i}{\mathbf{\Pi}}_{j} =\displaystyle= 𝚷iδij,subscript𝚷𝑖subscript𝛿𝑖𝑗\displaystyle{\mathbf{\Pi}}_{i}\delta_{ij}, (26)
(𝚷i𝐇,𝚷j𝐇)subscript𝚷𝑖𝐇subscript𝚷𝑗𝐇\displaystyle({\mathbf{\Pi}}_{i}{\bf H},{\mathbf{\Pi}}_{j}{\bf H}) =\displaystyle= 𝚷i𝐇2δij.superscriptnormsubscript𝚷𝑖𝐇2subscript𝛿𝑖𝑗\displaystyle||{\mathbf{\Pi}}_{i}{\bf H}||^{2}\delta_{ij}. (27)

This means that any Hermitian matrix 𝐇𝐇{\bf H} can be decomposed as a sum of four orthogonal components 𝐇i𝚷i𝐇subscript𝐇𝑖subscript𝚷𝑖𝐇{\bf H}_{i}\equiv{\mathbf{\Pi}}_{i}{\bf H}, so that its squared Hilbert-Schmidt norm can be decomposed as a sum of contributions from the four components:

𝐇𝐇\displaystyle{\bf H} =\displaystyle= 𝐇0+𝐇1+𝐇2+𝐇3,subscript𝐇0subscript𝐇1subscript𝐇2subscript𝐇3\displaystyle{\bf H}_{0}+{\bf H}_{1}+{\bf H}_{2}+{\bf H}_{3}, (28)
𝐇isubscript𝐇𝑖\displaystyle{\bf H}_{i} \displaystyle\equiv 𝚷i𝐇,subscript𝚷𝑖𝐇\displaystyle{\mathbf{\Pi}}_{i}{\bf H}, (29)
(𝐇i,𝐇j)subscript𝐇𝑖subscript𝐇𝑗\displaystyle({\bf H}_{i},{\bf H}_{j}) =\displaystyle= 𝐇i2δij,superscriptnormsubscript𝐇𝑖2subscript𝛿𝑖𝑗\displaystyle||{\bf H}_{i}||^{2}\delta_{ij}, (30)
𝐇2superscriptnorm𝐇2\displaystyle||{\bf H}||^{2} =\displaystyle= 𝐇02+𝐇12+𝐇22+𝐇32.superscriptnormsubscript𝐇02superscriptnormsubscript𝐇12superscriptnormsubscript𝐇22superscriptnormsubscript𝐇32\displaystyle||{\bf H}_{0}||^{2}\mskip-5.0mu+\mskip-5.0mu||{\bf H}_{1}||^{2}\mskip-5.0mu+\mskip-5.0mu||{\bf H}_{2}||^{2}\mskip-5.0mu+\mskip-5.0mu||{\bf H}_{3}||^{2}. (31)

We see that 𝐇0𝐈proportional-tosubscript𝐇0𝐈{\bf H}_{0}\propto{\bf I} picks out the trace of 𝐇𝐇{\bf H}, whereas the other three matrices are trace-free. This trace term is of course physically uninteresting, since it can be eliminated by simply adding an unobservable constant zero-point energy to the Hamiltonian. 𝐇1subscript𝐇1{\bf H}_{1} and 𝐇2subscript𝐇2{\bf H}_{2} corresponds to the two separable terms in equation (14) (without the trace term, which could have been arbitrarily assigned to either), and 𝐇3subscript𝐇3{\bf H}_{3} corresponds to the non-separable residual. A Hermitian matrix 𝐇𝐇{\bf H} is therefore separable if and only if 𝚷3𝐇=0subscript𝚷3𝐇0{\mathbf{\Pi}}_{3}{\bf H}=0. Just as it is customary to write the norm or a vector 𝐫𝐫{\bf r} by r|𝐫|𝑟𝐫r\equiv|{\bf r}| (without boldface), we will denote the Hilbert-Schmidt norm of a matrix 𝐇𝐇{\bf H} by H𝐇𝐻norm𝐇H\equiv||{\bf H}||. For example, with this notation we can rewrite equation (31) as simply H2=H02+H12+H22+H32superscript𝐻2superscriptsubscript𝐻02superscriptsubscript𝐻12superscriptsubscript𝐻22superscriptsubscript𝐻32H^{2}=H_{0}^{2}+H_{1}^{2}+H_{2}^{2}+H_{3}^{2}.

Geometrically, we can think of n×n𝑛𝑛n\times n Hermitian matrices 𝐇𝐇{\bf H} as points in the N𝑁N-dimensional vector space RNsuperscript𝑅𝑁R^{N}, where N=n×n𝑁𝑛𝑛N=n\times n (Hermiteal matrices have n𝑛n real numbers on the diagonal and n(n1)/2𝑛𝑛12n(n-1)/2 complex numbers off the diagonal, constituting a total of n+2×n(n1)/2=n2𝑛2𝑛𝑛12superscript𝑛2n+2\times n(n-1)/2=n^{2} real parameters). Diagonal matrices form a hyperplane of dimension n𝑛n in this space. The projection operators 𝚷0subscript𝚷0{\mathbf{\Pi}}_{0}, 𝚷1subscript𝚷1{\mathbf{\Pi}}_{1}, 𝚷2subscript𝚷2{\mathbf{\Pi}}_{2} and 𝚷3subscript𝚷3{\mathbf{\Pi}}_{3} project onto hyperplanes of dimension 111, (n1)𝑛1(n-1), (n1)𝑛1(n-1) and (n1)2superscript𝑛12(n-1)^{2}, respectively, so separable matrices form a hyperplane in this space of dimension 2n12𝑛12n-1. For example, a general 4×4444\times 4 Hermitian matrix can be parametrized by 10 numbers (4 real for the diagonal part and 6 complex for the off-diagonal part), and its decomposition from equation (28) can be written as follows:

00bd00db)+𝑡0000𝑡0000𝑡0000𝑡𝑎0𝑐00𝑎0𝑐fragmentsc0fragmentsa00fragmentsc0fragmentsalimit-fromfragments fragments 00𝑏𝑑00fragmentsdfragmentsb\displaystyle\left(\mskip-3.0mu\begin{tabular}[]{cccc}$t$&$0$&$0$&$0$\\ $0$&$t$&$0$&$0$\\ $0$&$0$&$t$&$0$\\ $0$&$0$&$0$&$t$\end{tabular}\mskip-3.0mu\right)\mskip-5.0mu+\mskip-5.0mu\left(\mskip-3.0mu\begin{tabular}[]{cccc}$a$&$0$&$c$&$0$\\ $0$&$a$&$0$&$c$\\ $c^{*}$&$0$&$-a$&$0$\\ $0$&$c^{*}$&$0$&$-a$\end{tabular}\mskip-3.0mu\right)\mskip-5.0mu+\mskip-5.0mu\left(\mskip-3.0mu\begin{tabular}[]{cccc}$b$&$d$&$0$&$0$\\ $d^{*}$&$-b$&$0$&$0$\\ $0$&$0$&$b$&$d$\\ $0$&$0$&$d^{*}$&$-b$\end{tabular}\mskip-3.0mu\right)\mskip-5.0mu+\mskip-5.0mu
𝐇𝐇\displaystyle{\bf H} =\displaystyle= (t+a+b+vd+wc+xyd+wt+abvzcxc+xzta+bvdwycxdwtab+v)=fragmentstabvfragmentsdwfragmentscx𝑦fragmentsdwfragmentstabv𝑧fragmentscxfragmentscxfragmentszfragmentstabvfragmentsdwfragmentsyfragmentscxfragmentsdwfragmentstabvabsent\displaystyle\left(\begin{tabular}[]{cccc}$t\mskip-3.0mu+\mskip-3.0mua\mskip-3.0mu+\mskip-3.0mub\mskip-3.0mu+\mskip-3.0muv$&$d\mskip-3.0mu+\mskip-3.0muw$&$c\mskip-3.0mu+\mskip-3.0mux$&$y$\\ $d^{*}\mskip-3.0mu+\mskip-3.0muw^{*}$&$t\mskip-3.0mu+\mskip-3.0mua\mskip-3.0mu-\mskip-3.0mub\mskip-3.0mu-\mskip-3.0muv$&$z$&$c\mskip-3.0mu-\mskip-3.0mux$\\ $c^{*}\mskip-3.0mu+\mskip-3.0mux^{*}$&$z^{*}$&$t\mskip-3.0mu-\mskip-3.0mua\mskip-3.0mu+\mskip-3.0mub\mskip-3.0mu-\mskip-3.0muv$&$d\mskip-3.0mu-\mskip-3.0muw$\\ $y^{*}$&$c^{*}\mskip-3.0mu-\mskip-3.0mux^{*}$&$d^{*}\mskip-3.0mu-\mskip-3.0muw^{*}$&$t\mskip-3.0mu-\mskip-3.0mua\mskip-3.0mu-\mskip-3.0mub\mskip-3.0mu+\mskip-3.0muv$\\ \end{tabular}\right)= (36)
=\displaystyle= (t0000t0000t0000t)+(a0c00a0cc0a00c0a)+( bd00d-b00bd00d-b00 (49)
+\displaystyle+ (vwxywvzxxzvwyxwv)𝑣𝑤𝑥𝑦fragmentswfragmentsv𝑧fragmentsxfragmentsxfragmentszfragmentsvfragmentswfragmentsyfragmentsxfragmentsw𝑣\displaystyle\left(\begin{tabular}[]{cccc}$v$&$w$&$x$&$y$\\ $w^{*}$&$-v$&$z$&$-x$\\ $x^{*}$&$z^{*}$&$-v$&$-w$\\ $y^{*}$&$-x^{*}$&$-w^{*}$&$v$\\ \end{tabular}\right) (54)

We see that t𝑡t contributes to the trace (and 𝐇0subscript𝐇0{\bf H}_{0}) while the other three components 𝐇isubscript𝐇𝑖{\bf H}_{i} are traceless. We also see that tr1𝐇2=tr2𝐇1=0subscripttr1subscript𝐇2subscripttr2subscript𝐇10\hbox{tr}\,_{1}{\bf H}_{2}=\hbox{tr}\,_{2}{\bf H}_{1}=0, and that both partial traces vanish for 𝐇3subscript𝐇3{\bf H}_{3}.

III.10 Maximizing separability

We now have all the tools we need to rigorously maximize separability and test the physics-from-scratch approach described in Section III.7. Given a Hamiltonian 𝐇𝐇{\bf H}, we simply wish to minimize the norm of its non-separable component 𝐇3subscript𝐇3{\bf H}_{3} over all possible Hilbert space factorizations, i.e., over all possible unitary transformations. In other words, we wish to compute

E̊minU𝚷3𝐇,̊𝐸subscript𝑈normsubscript𝚷3𝐇\mathring{E}\equiv\min_{U}||{\mathbf{\Pi}}_{3}{\bf H}||, (55)

where we have defined the integration energy E̊̊𝐸\mathring{E} by analogy with the integrated information ΦΦ\Phi. If E̊=0̊𝐸0\mathring{E}=0, then there is a basis where our system separates into two parallel universes, otherwise E̊̊𝐸\mathring{E} quantifies the coupling between the two parts of the system under the cruelest cut.

The Hilbert-Schmidt space allows us to interpret the minimization problem of equation (55) geometrically, as illustrated in Figure 8. Let 𝐇superscript𝐇{\bf H}^{*} denote the Hamiltonian in some given basis, and consider its orbit 𝐇=𝐔𝐇𝐔𝐇superscript𝐔𝐇𝐔{\bf H}={\bf U}{\bf H}{\bf U}^{\dagger} under all unitary transformations 𝐔𝐔{\bf U}. This is a curved hypersurface whose dimensionality is generically n(n1)𝑛𝑛1n(n-1), i.e., n𝑛n lower than that of the full space of Hermitian matrices, since unitary transformation leave all n𝑛n eigenvalues invariant.111111n×n𝑛𝑛n\times n-dimensional Unitary matrices 𝐔𝐔{\bf U} are known to form an n×n𝑛𝑛n\times n-dimensional manifold: they can always be written as 𝐔=ei𝐇𝐔superscript𝑒𝑖𝐇{\bf U}=e^{i{\bf H}} for some Hermitian matrix 𝐇𝐇{\bf H}, so they are parametrized by the same number of real parameters (n×n𝑛𝑛n\times n) as Hermitian matrices. We will refer to this curved hypersurface as a subsphere, because it is a subset of the full n2superscript𝑛2n^{2}-dimensional sphere: the radius H𝐻H (the Hilbert-Schmidt norm 𝐇norm𝐇||{\bf H}||) is invariant under unitary transformations, but the subsphere may have a more complicated topology than a hypersphere; for example, the 3-sphere is known to topologically be the double cover of SO(3), the matrix group of 3×3333\times 3 orthonormal transformations.

We are interested in finding the most separable point 𝐇𝐇{\bf H} on this subsphere, i.e., the point on the subsphere that is closest to the (2n1)2𝑛1(2n-1)-dimensional separable hyperplane. In our notation, this means that we want to find the point 𝐇𝐇{\bf H} on the subsphere that minimizes 𝚷3𝐇normsubscript𝚷3𝐇||{\mathbf{\Pi}}_{3}{\bf H}||, the Hilbert-Schmidt norm of the non-separable component. If we perform infinitesimal displacements along the subsphere, 𝚷3𝐇normsubscript𝚷3𝐇||{\mathbf{\Pi}}_{3}{\bf H}|| thus remains constant to first order (the gradient vanishes at the minimum), so all tangent vectors of the subsphere are orthogonal to 𝚷3𝐇subscript𝚷3𝐇{\mathbf{\Pi}}_{3}{\bf H}, the vector from the separable hyperplane to the subsphere.

Unitary transformations are generated by anti-Hermitian matrices, so the most general tangent vector δ𝐇𝛿𝐇\delta{\bf H} is of the form

δ𝐇=[𝐀,𝐇]𝐀𝐇𝐇𝐀𝛿𝐇𝐀𝐇𝐀𝐇𝐇𝐀\delta{\bf H}=[{\bf A},{\bf H}]\equiv{\bf A}{\bf H}-{\bf H}{\bf A} (56)

for some anti-Hermitian n×n𝑛𝑛n\times n matrix 𝐀𝐀{\bf A} (any matrix satisfying 𝐀=𝐀superscript𝐀𝐀{\bf A}^{\dagger}=-{\bf A}). We thus obtain the following simple condition for maximal separability:

(𝚷3𝐇,[𝐀,𝐇])=0subscript𝚷3𝐇𝐀𝐇0({\mathbf{\Pi}}_{3}{\bf H},[{\bf A},{\bf H}])=0 (57)

for any anti-Hermitian matrix 𝐀𝐀{\bf A}. Because the most general anti-Hermitian matrix can be written as 𝐀=i𝐁𝐀𝑖𝐁{\bf A}=i{\bf B} for a Hermitian matrix 𝐁𝐁{\bf B}, equation (57) is equivalent to the condition (𝚷3𝐇,[𝐁,𝐇])=0subscript𝚷3𝐇𝐁𝐇0({\mathbf{\Pi}}_{3}{\bf H},[{\bf B},{\bf H}])=0 for all Hermitian matrices 𝐁𝐁{\bf B}. Since there are n2superscript𝑛2n^{2} anti-Hermitian matrices, equation (57) is a system of n2superscript𝑛2n^{2} coupled quadratic equations that the components of 𝐇𝐇{\bf H} must obey.

Refer to caption

Figure 8: Geometrically, we can view the integration energy as the shortest distance (in Hilbert-Schmidt norm) between the hyperplane of separable Hamiltonians and a subsphere of Hamiltonians that can be unitarily transformed into one another. The most separable Hamiltonian 𝐇𝐇{\bf H} on the subsphere is such that its non-separable component 𝚷3subscript𝚷3{\mathbf{\Pi}}_{3} is orthogonal to all subsphere tangent vectors [𝐀,𝐇]𝐀𝐇[{\bf A},{\bf H}] generated by anti-Hermitian matrices 𝐀𝐀{\bf A}.

III.11 The Hamiltonian diagonality theorem

Analogously to the above-mentioned ρ𝜌\rho-diagonality theorem, we will now prove that maximal separability is attained in the eigenbasis.

𝐇𝐇{\bf H}-Diagonality Theorem (HDT):
The Hamiltonian is always maximally separable (minimizing 𝐇3normsubscript𝐇3||{\bf H}_{3}||) in the energy eigenbasis where it is diagonal.

As a preliminary, let us first prove the following:

Lemma 1: For any Hermitian positive semidefinite matrix 𝐇𝐇{\bf H}, there is a diagonal matrix 𝐇subscript𝐇{\bf H}_{*} giving the same subsystem eigenvalue spectra, 𝛌(𝚷1𝐇)=𝛌(𝚷1𝐇)𝛌subscript𝚷1subscript𝐇𝛌subscript𝚷1𝐇{\boldsymbol{\lambda}}({\mathbf{\Pi}}_{1}{\bf H}_{*})={\boldsymbol{\lambda}}({\mathbf{\Pi}}_{1}{\bf H}), 𝛌(𝚷2𝐇)=𝛌(𝚷2𝐇)𝛌subscript𝚷2subscript𝐇𝛌subscript𝚷2𝐇{\boldsymbol{\lambda}}({\mathbf{\Pi}}_{2}{\bf H}_{*})={\boldsymbol{\lambda}}({\mathbf{\Pi}}_{2}{\bf H}), and whose eigenvalue spectrum is majorized by that of 𝐇𝐇{\bf H}, i.e., 𝛌(𝐇)𝛌(𝐇)succeeds𝛌𝐇𝛌subscript𝐇{\boldsymbol{\lambda}}({\bf H})\succ{\boldsymbol{\lambda}}({\bf H}_{*}).

Proof: Define the matrix 𝐇𝐔𝐇𝐔superscript𝐇superscript𝐔𝐇𝐔{\bf H}^{\prime}\equiv{\bf U}{\bf H}{\bf U}^{\dagger}, where 𝐔𝐔1𝐔2𝐔tensor-productsubscript𝐔1subscript𝐔2{\bf U}\equiv{\bf U}_{1}\otimes{\bf U}_{2}, and 𝐔1subscript𝐔1{\bf U}_{1} and 𝐔2subscript𝐔2{\bf U}_{2} are unitary matrices diagonalizing the partial trace matrices tr2𝐇subscripttr2𝐇\hbox{tr}\,_{2}{\bf H} and tr1𝐇subscripttr1𝐇\hbox{tr}\,_{1}{\bf H}, respectively. This implies that tr1𝐇subscripttr1superscript𝐇\hbox{tr}\,_{1}{\bf H}^{\prime} and tr2𝐇subscripttr2superscript𝐇\hbox{tr}\,_{2}{\bf H}^{\prime} are diagonal, and 𝝀(𝐇)=𝝀(𝐇)𝝀superscript𝐇𝝀𝐇{\boldsymbol{\lambda}}({\bf H}^{\prime})={\boldsymbol{\lambda}}({\bf H}). Now define the matrix 𝐇subscript𝐇{\bf H}_{*} to be 𝐇superscript𝐇{\bf H}^{\prime} with all off-diagonal elements set to zero. Then tr1𝐇=tr1𝐇subscripttr1subscript𝐇subscripttr1superscript𝐇\hbox{tr}\,_{1}{\bf H}_{*}=\hbox{tr}\,_{1}{\bf H}^{\prime} and tr2𝐇=tr2𝐇subscripttr2subscript𝐇subscripttr2superscript𝐇\hbox{tr}\,_{2}{\bf H}_{*}=\hbox{tr}\,_{2}{\bf H}^{\prime}, so 𝝀(𝚷1𝐇)=𝝀(𝚷1𝐇)𝝀subscript𝚷1subscript𝐇𝝀subscript𝚷1𝐇{\boldsymbol{\lambda}}({\mathbf{\Pi}}_{1}{\bf H}_{*})={\boldsymbol{\lambda}}({\mathbf{\Pi}}_{1}{\bf H}) and 𝝀(𝚷2𝐇)=𝝀(𝚷2𝐇)𝝀subscript𝚷2subscript𝐇𝝀subscript𝚷2𝐇{\boldsymbol{\lambda}}({\mathbf{\Pi}}_{2}{\bf H}_{*})={\boldsymbol{\lambda}}({\mathbf{\Pi}}_{2}{\bf H}). Moreover, since the eigenvalues of any Hermitian positive semidefinite matrix majorize its diagonal elements MarshallBook , 𝝀(𝐇)𝝀(𝐇)=𝝀(𝐇)precedes𝝀subscript𝐇𝝀superscript𝐇𝝀𝐇{\boldsymbol{\lambda}}({\bf H}_{*})\prec{\boldsymbol{\lambda}}({\bf H}^{\prime})={\boldsymbol{\lambda}}({\bf H}), which completes the proof.

Lemma 2: The set S(𝐇)𝑆𝐇S({\bf H}) of all diagonal matrices whose diagonal elements are majorized by the vector 𝛌(𝐇)𝛌𝐇{\boldsymbol{\lambda}}({\bf H}) is a convex subset of the subsphere, with boundary points on the surface of the subsphere that are diagonal matrices with all permutations of 𝛌(𝐇)𝛌𝐇{\boldsymbol{\lambda}}({\bf H}).

Proof: Any matrix 𝐇S(𝐇)subscript𝐇𝑆𝐇{\bf H}_{*}\in S({\bf H}) must lie either on the subsphere surface or in its interior, because of the well-known result that for any two positive semidefinite Hermitian matrices of equal trace, the majorization condition 𝝀(𝐇)𝝀(𝐇)precedes𝝀subscript𝐇𝝀𝐇{\boldsymbol{\lambda}}({\bf H}_{*})\prec{\boldsymbol{\lambda}}({\bf H}) is equivalent to the former lying in the convex hull of the unitary orbit of the latter Bravyi03 : 𝐇=ipi𝐔i𝐇𝐔isubscript𝐇subscript𝑖subscript𝑝𝑖subscript𝐔𝑖superscriptsubscript𝐇𝐔𝑖{\bf H}_{*}=\sum_{i}p_{i}{\bf U}_{i}{\bf H}{\bf U}_{i}^{\dagger}, pi0subscript𝑝𝑖0p_{i}\geq 0, ipi=1subscript𝑖subscript𝑝𝑖1\sum_{i}p_{i}=1, 𝐔i𝐔i=𝐈subscript𝐔𝑖superscriptsubscript𝐔𝑖𝐈{\bf U}_{i}{\bf U}_{i}^{\dagger}={\bf I}. S(𝐇)𝑆𝐇S({\bf H}) contains the above-mentioned boundary points, because they can be written as 𝐔𝐇𝐔superscript𝐔𝐇𝐔{\bf U}{\bf H}{\bf U}^{\dagger} for all unitary matrices 𝐔𝐔{\bf U} that diagonalize 𝐇𝐇{\bf H}, and for a diagonal matrix, the corresponding 𝐇subscript𝐇{\bf H}_{*} is simply the matrix itself. The set S(𝐇)𝑆𝐇S({\bf H}) is convex, because the convexity condition that p𝝀1+(1p)𝝀2𝝀succeeds𝑝subscript𝝀11𝑝subscript𝝀2𝝀p{\boldsymbol{\lambda}}_{1}+(1-p){\boldsymbol{\lambda}}_{2}\succ{\boldsymbol{\lambda}} if 𝝀1𝝀succeedssubscript𝝀1𝝀{\boldsymbol{\lambda}}_{1}\succ{\boldsymbol{\lambda}}, 𝝀2𝝀succeedssubscript𝝀2𝝀{\boldsymbol{\lambda}}_{2}\succ{\boldsymbol{\lambda}}, 0p10𝑝10\leq p\leq 1 follows straight from the definition of succeeds\succ.

Lemma 3: The function f(𝐇)𝚷1𝐇2+𝚷2𝐇2𝑓𝐇superscriptnormsubscript𝚷1𝐇2superscriptnormsubscript𝚷2𝐇2f({\bf H})\equiv||{\mathbf{\Pi}}_{1}{\bf H}||^{2}+||{\mathbf{\Pi}}_{2}{\bf H}||^{2} is convex, i.e., satisfies f(pa𝐇a+pb𝐇b)paf(𝐇a)+pbf(𝐇b)𝑓subscript𝑝𝑎subscript𝐇𝑎subscript𝑝𝑏subscript𝐇𝑏subscript𝑝𝑎𝑓subscript𝐇𝑎subscript𝑝𝑏𝑓subscript𝐇𝑏f(p_{a}{\bf H}_{a}+p_{b}{\bf H}_{b})\leq p_{a}f({\bf H}_{a})+p_{b}f({\bf H}_{b}) for any constants satisfying pa0subscript𝑝𝑎0p_{a}\geq 0, pb0subscript𝑝𝑏0p_{b}\geq 0, pa+pb=1subscript𝑝𝑎subscript𝑝𝑏1p_{a}+p_{b}=1.

Proof: If we arrange the elements of 𝐇𝐇{\bf H} into a vector 𝐡𝐡{\bf h} and denote the action of the superoperators 𝚷isubscript𝚷𝑖{\mathbf{\Pi}}_{i} on 𝐡𝐡{\bf h} by matrices 𝐏isubscript𝐏𝑖{\bf P}_{i}, then f(𝐇)=|𝐏1𝐡|2+|𝐏2𝐡|2=𝐡(𝐏1𝐏1+𝐏2𝐏2)𝐡𝑓𝐇superscriptsubscript𝐏1𝐡2superscriptsubscript𝐏2𝐡2superscript𝐡superscriptsubscript𝐏1subscript𝐏1superscriptsubscript𝐏2subscript𝐏2𝐡f({\bf H})=|{\bf P}_{1}{\bf h}|^{2}+|{\bf P}_{2}{\bf h}|^{2}={\bf h}^{\dagger}({\bf P}_{1}^{\dagger}{\bf P}_{1}+{\bf P}_{2}^{\dagger}{\bf P}_{2}){\bf h}. Since the matrix in parenthesis is symmetric and positive semidefinite, the function f𝑓f is a positive semidefinite quadratic form and hence convex.


We are now ready to prove the 𝐇𝐇{\bf H}-diagonality theorem. This is equivalent to proving that f(𝐇)𝑓𝐇f({\bf H}) takes its maximum value on the subsphere in Figure 8 for a diagonal 𝐇𝐇{\bf H}: since both 𝐇norm𝐇||{\bf H}|| and 𝐇0normsubscript𝐇0||{\bf H}_{0}|| are unitarily invariant, minimizing 𝐇32=𝐇2𝐇02f(𝐇)superscriptnormsubscript𝐇32superscriptnorm𝐇2superscriptnormsubscript𝐇02𝑓𝐇||{\bf H}_{3}||^{2}=||{\bf H}||^{2}-||{\bf H}_{0}||^{2}-f({\bf H}) is equivalent to maximizing f(𝐇)𝑓𝐇f({\bf H}).

Let O(𝐇)𝑂𝐇O({\bf H}) denote the subphere, i.e., the unitary orbit of 𝐇𝐇{\bf H}. By Lemma 1, for every 𝐇O(H)𝐇𝑂𝐻{\bf H}\in O(H), there is an 𝐇S(𝐇)subscript𝐇𝑆𝐇{\bf H}_{*}\in S({\bf H}) such that f(𝐇)=f(𝐇)𝑓𝐇𝑓subscript𝐇f({\bf H})=f({\bf H}_{*}). If f𝑓f takes its maximum over S(𝐇)𝑆𝐇S({\bf H}) at a point 𝐇subscript𝐇{\bf H}_{*} which also belongs to O(𝐇)𝑂𝐇O({\bf H}), then this is therefore also the maximum of f𝑓f over O(𝐇)𝑂𝐇O({\bf H}). Since the function f𝑓f is convex (by Lemma 3) and the set S(𝐇)𝑆𝐇S({\bf H}) is convex (by Lemma 2), f𝑓f cannot have any local maxima within the set and must take its maximum value at at least one point on the boundary of the set. As per Lemma 2, these boundary points are diagonal matrices with all permutations of the eigenvalues of 𝐇𝐇{\bf H}, so they also belong to O(𝐇)𝑂𝐇O({\bf H}) and therefore constitute maxima of f𝑓f over the subsphere. In other words, the Hamiltonian is always maximally separable in its energy eigenbasis, q.e.d.

This result holds also for Hamiltonians with negative eigenvalues, since we can make all eigenvalues positive by adding an 𝐇0subscript𝐇0{\bf H}_{0}-component without altering the optimization problem. In addition to the diagonal optimum, there will generally be other bases with identical values of 𝐇3normsubscript𝐇3||{\bf H}_{3}||, corresponding to separable unitary transformations of the diagonal optimum.

We have thus proved that separability is always maximized in the energy eigenbasis, where the n×n𝑛𝑛n\times n matrix 𝐇𝐇{\bf H} is diagonal and the projection operators 𝚷isubscript𝚷𝑖{\mathbf{\Pi}}_{i} defined by equations (21)-(24) greatly simplify. If we arrange the n=lm𝑛𝑙𝑚n=lm diagonal elements of 𝐇𝐇{\bf H} into an l×m𝑙𝑚l\times m matrix H𝐻H, then the action of the linear operators 𝚷isubscript𝚷𝑖{\mathbf{\Pi}}_{i} is given by simple matrix operations:

H0subscript𝐻0\displaystyle H_{0} QlHQm,absentsubscript𝑄𝑙𝐻subscript𝑄𝑚\displaystyle\equiv Q_{l}HQ_{m}, (58)
H1subscript𝐻1\displaystyle H_{1} PlHQm,absentsubscript𝑃𝑙𝐻subscript𝑄𝑚\displaystyle\equiv P_{l}HQ_{m}, (59)
H2subscript𝐻2\displaystyle H_{2} QlHPm,absentsubscript𝑄𝑙𝐻subscript𝑃𝑚\displaystyle\equiv Q_{l}HP_{m}, (60)
H3subscript𝐻3\displaystyle H_{3} PlHPm,absentsubscript𝑃𝑙𝐻subscript𝑃𝑚\displaystyle\equiv P_{l}HP_{m}, (61)

where

Pksubscript𝑃𝑘\displaystyle P_{k} \displaystyle\equiv IQk,𝐼subscript𝑄𝑘\displaystyle I-Q_{k}, (62)
(Qk)ijsubscriptsubscript𝑄𝑘𝑖𝑗\displaystyle(Q_{k})_{ij} \displaystyle\equiv 1k1𝑘\displaystyle{1\over k} (63)

are k×k𝑘𝑘k\times k projection matrices satisfying Pk2=Pksuperscriptsubscript𝑃𝑘2subscript𝑃𝑘P_{k}^{2}=P_{k}, Qk2=Qksuperscriptsubscript𝑄𝑘2subscript𝑄𝑘Q_{k}^{2}=Q_{k}, PkQk=QkPk=0subscript𝑃𝑘subscript𝑄𝑘subscript𝑄𝑘subscript𝑃𝑘0P_{k}Q_{k}=Q_{k}P_{k}=0, Pk+Qk=Isubscript𝑃𝑘subscript𝑄𝑘𝐼P_{k}+Q_{k}=I. (To avoid confusion, we are using boldface for n×n𝑛𝑛n\times n matrices and plain font for smaller matrices involving only the eigenvalues.) For the n=2×2𝑛22n=2\times 2 example of equation (36), we have

P2=(12121212),Q2=12(12121212),formulae-sequencesubscript𝑃212121212subscript𝑄21212fragments12fragments1212{P_{2}=\left(\begin{tabular}[]{cccc}${1\over 2}$&${1\over 2}$\\ ${1\over 2}$&${1\over 2}$\end{tabular}\right),\quad Q_{2}={1\over 2}\left(\begin{tabular}[]{cccc}${1\over 2}$&$-{1\over 2}$\\ $-{1\over 2}$&${1\over 2}$\end{tabular}\right),} (64)

and a general diagonal 𝐇𝐇{\bf H} is decomposed into four terms H=H0+H1+H2+H3𝐻subscript𝐻0subscript𝐻1subscript𝐻2subscript𝐻3H=H_{0}+H_{1}+H_{2}+H_{3} as follows:

H=(tttt)+(aaaa)+(bbbb)+(vvvv).𝐻𝑡𝑡𝑡𝑡𝑎𝑎fragmentsafragmentsa𝑏fragmentsb𝑏fragmentsb𝑣fragmentsvfragmentsv𝑣H=\left(\begin{tabular}[]{cccc}$t$&$t$\\ $t$&$t$\end{tabular}\right)+\left(\begin{tabular}[]{cccc}$a$&$a$\\ $-a$&$-a$\end{tabular}\right)+\left(\begin{tabular}[]{cccc}$b$&$-b$\\ $b$&$-b$\end{tabular}\right)+\left(\begin{tabular}[]{cccc}$v$&$-v$\\ $-v$&$v$\end{tabular}\right). (65)

As expected, only the last matrix is non-separable, and the row/column sums vanish for the two previous matrices, corresponding to vanishing partial traces.

Note that we are here choosing the n𝑛n basis states of the full Hilbert space to be products of basis states from the two factor spaces. This is without loss of generality, since any other basis states can be transformed into such product states by a unitary transformation.

Finally, note that the theorem above applies only to exact finite-dimensional Hamiltonians, not to approximate discretizations of infinite-dimensional ones such as are frequently employed in physics. If n𝑛n is not factorizable, the 𝐇𝐇{\bf H}-factorization problem can be rigorously mapped onto a physically indistinguishable one with a slightly larger factorizable n𝑛n by setting the corresponding new rows and columns of the density matrix ρ𝜌\rho equal to zero, so that the new degrees of freedom are all frozen out — we will discuss this idea in more detail in in Section IV.6.

III.12 Ultimate independence and the Quantum Zeno paradox

Refer to caption

Figure 9: If the Hamiltonian of a system commutes with the interaction Hamiltonian ([𝐇1,𝐇3]=0subscript𝐇1subscript𝐇30[{\bf H}_{1},{\bf H}_{3}]=0), then decoherence drives the system toward a time-independent state ρ𝜌\rho where nothing ever changes. The figure illustrates this for the Bloch Sphere of a single qubit starting in a pure state and ending up in a fully mixed state ρ=𝐈/2𝜌𝐈2\rho={\bf I}/2. More general initial states end up somewhere along the z𝑧z-axis. Here 𝐇1σzproportional-tosubscript𝐇1subscript𝜎𝑧{\bf H}_{1}\propto\sigma_{z}, generating a simple precession around the z𝑧z-axis.

In Section III.7, we began exploring the idea that if we divide the world into maximally independent parts (with minimal interaction Hamiltonians), then the observed object hierarchy from Figure 1 would emerge. The HDT tells us that this decomposition (factorization) into maximally independent parts can be performed in the energy eigenbasis of the total Hamiltonian. This means that all subsystem Hamiltonians and all interaction Hamiltonians commute with one another, corresponding to an essentially classical world where none of the quantum effects associated with non-commutativity manifest themselves! In contrast, many systems that we customarily refer to as objects in our classical world do not commute with their interaction Hamiltonians: for example, the Hamiltonian governing the dynamics of a baseball involves its momentum, which does not commute with the position-dependent potential energy due to external forces.

As emphasized by Zurek Zurek01 , states commuting with the interaction Hamiltonian form a “pointer basis” of classically observable states, playing an important role in understanding the emergence of a classical world. The fact that the independence principle automatically leads to commutativity with interaction Hamiltonians might therefore be taken as an encouraging indication that we are on the right track. However, whereas the pointer states in Zurek’s examples evolve over time due to the system’s own Hamiltonian 𝐇1subscript𝐇1{\bf H}_{1}, those in our independence-maximizing decomposition do not, because they commute also with 𝐇1subscript𝐇1{\bf H}_{1}. Indeed, the situation is even worse, as illustrated in Figure 9: any time-dependent system will evolve into a time-independent one, as environment-induced decoherence Zeh70 ; JZ85 ; ZurekHabibPaz93 ; ZehBook ; Zurek09 ; SchlosshauerBook drives it towards an eigenstate of the interaction Hamiltonian, i.e., an energy eigenstate.121212For a system with a finite environment, the entropy will eventually decrease again, causing the resumption of time-dependence, but this Poincaré recurrence time grows exponentially with environment size and is normally large enough that decoherence can be approximated as permanent.

The famous Quantum Zeno effect, whereby a system can cease to evolve in the limit where it is arbitrarily strongly coupled to its environment Sudarshan77 , thus has a stronger and more pernicious cousin, which we will term the Quantum Zeno Paradox or the Independence Paradox.

Quantum Zeno Paradox:
If we decompose our universe into maximally independent objects, then all change grinds to a halt.

In summary, we have tried to understand the emergence of our observed semiclassical world, with its hierarchy of moving objects, by decomposing the world into maximally independent parts, but our attempts have failed dismally, producing merely a timeless world reminiscent of heat death. In Section II.7, we saw that using the integration principle alone led to a similarly embarrassing failure, with no more than a quarter of a bit of integrated information possible. At least one more principle is therefore needed.

IV Dynamics and autonomy

Let us now explore the implications of the dynamics principle from Table 2, according to which a conscious system has the capacity to not only store information, but also to process it. As we just saw above, there is an interesting tension between this principle and the independence principle, whose Quantum Zeno Paradox gives the exact opposite: no dynamics and no information processing at all.

We will term the synthesis of these two competing principles the autonomy principle: a conscious system has substantial dynamics and independence. When exploring autonomous systems below, we can no longer study the state ρ𝜌\rho and the Hamiltonian 𝐇𝐇{\bf H} separately, since their interplay is crucial. Indeed, we well see that there are interesting classes of states ρ𝜌\rho that provide substantial dynamics and near-perfect independence even when the interaction Hamiltonian 𝐇3subscript𝐇3{\bf H}_{3} is not small. In other words, for certain preferred classes of states, the independence principle no longer pushes us to simply minimize H3subscript𝐻3H_{3} and face the Quantum Zeno Paradox.

IV.1 Probability velocity and energy coherence

To obtain a quantitative measure of dynamics, let us first define the probability velocity 𝐯𝐩˙𝐯˙𝐩{\bf v}\equiv\dot{\bf p}, where the probability vector 𝐩𝐩{\bf p} is given by piρiisubscript𝑝𝑖subscript𝜌𝑖𝑖p_{i}\equiv\rho_{ii}. In other words,

vk=ρ˙kk=i[𝐇,ρ]kk.subscript𝑣𝑘subscript˙𝜌𝑘𝑘𝑖subscript𝐇𝜌𝑘𝑘v_{k}=\dot{\rho}_{kk}=i[{\bf H},\rho]_{kk}. (66)

Since 𝐯𝐯{\bf v} is basis-dependent, we are interested in finding the basis where

v2kvk2=k(ρ˙kk)2superscript𝑣2subscript𝑘superscriptsubscript𝑣𝑘2subscript𝑘superscriptsubscript˙𝜌𝑘𝑘2v^{2}\equiv\sum_{k}v_{k}^{2}=\sum_{k}(\dot{\rho}_{kk})^{2} (67)

is maximized, i.e., the basis where the sums of squares of the diagonal elements of ρ˙˙𝜌\dot{\rho} is maximal. It is easy to see that this basis is the eigenbasis of ρ˙˙𝜌\dot{\rho}:

v2superscript𝑣2\displaystyle v^{2} =\displaystyle= k(ρ˙kk)2=jk(ρ˙jk)2jk(ρ˙jk)2subscript𝑘superscriptsubscript˙𝜌𝑘𝑘2subscript𝑗𝑘superscriptsubscript˙𝜌𝑗𝑘2subscript𝑗𝑘superscriptsubscript˙𝜌𝑗𝑘2\displaystyle\sum_{k}(\dot{\rho}_{kk})^{2}=\sum_{jk}(\dot{\rho}_{jk})^{2}-\sum_{j\neq k}(\dot{\rho}_{jk})^{2} (68)
=\displaystyle= ρ˙2jk(ρ˙jk)2superscriptnorm˙𝜌2subscript𝑗𝑘superscriptsubscript˙𝜌𝑗𝑘2\displaystyle||\dot{\rho}||^{2}-\sum_{j\neq k}(\dot{\rho}_{jk})^{2}

is clearly maximized in the eigenbasis where all off-diagonal elements in the last term vanish, since the Hilbert-Schmidt norm ρ˙norm˙𝜌||\dot{\rho}|| is the same in every basis; ρ˙2=trρ˙2superscriptnorm˙𝜌2trsuperscript˙𝜌2||\dot{\rho}||^{2}=\hbox{tr}\,\dot{\rho}^{2}, which is simply the sum of the squares of the eigenvalues of ρ˙˙𝜌\dot{\rho}.

Let us define the energy coherence

δH𝛿𝐻\displaystyle\delta H \displaystyle\equiv 12ρ˙=12i[𝐇,ρ]=tr{[𝐇,ρ]2}212norm˙𝜌12norm𝑖𝐇𝜌trsuperscript𝐇𝜌22\displaystyle{1\over\sqrt{2}}||\dot{\rho}||={1\over\sqrt{2}}||i[{\bf H},\rho]||=\sqrt{-\hbox{tr}\,\{[{\bf H},\rho]^{2}\}\over 2} (69)
=\displaystyle= tr[𝐇2ρ2𝐇ρ𝐇ρ].trdelimited-[]superscript𝐇2superscript𝜌2𝐇𝜌𝐇𝜌\displaystyle\sqrt{\hbox{tr}\,[{\bf H}^{2}\rho^{2}-{\bf H}\rho{\bf H}\rho]}.

For a pure state ρ=|ψψ|𝜌ket𝜓bra𝜓\rho=|\psi\rangle\langle\psi|, this definition implies that δHΔH𝛿𝐻Δ𝐻\delta H\equiv\Delta H, where ΔHΔ𝐻\Delta H is the energy uncertainty

ΔH=[ψ|𝐇2|ψψ|𝐇|ψ2]1/2,Δ𝐻superscriptdelimited-[]quantum-operator-product𝜓superscript𝐇2𝜓superscriptquantum-operator-product𝜓𝐇𝜓212\Delta H=\left[\langle\psi|{\bf H}^{2}|\psi\rangle-\langle\psi|{\bf H}|\psi\rangle^{2}\right]^{1/2}, (70)

so we can think of δH𝛿𝐻\delta H as the coherent part of the energy uncertainty, i.e., as the part that is due to quantum rather than classical uncertainty.

Since ρ˙=[𝐇,ρ]=2δHnorm˙𝜌norm𝐇𝜌2𝛿𝐻||\dot{\rho}||=||[{\bf H},\rho]||=\sqrt{2}\delta H, we see that the maximum possible probability velocity v𝑣v is simply

vmax=2δH,subscript𝑣max2𝛿𝐻{v_{\rm max}}=\sqrt{2}\>\delta H, (71)

so we can equivalently use either of v𝑣v or δH𝛿𝐻\delta H as convenient measures of quantum dynamics.131313The fidelity between the state ψ(t)𝜓𝑡\psi(t) and the initial state ψ0subscript𝜓0\psi_{0} is defined as F(t)ψ0|ψ(t),𝐹𝑡inner-productsubscript𝜓0𝜓𝑡F(t)\equiv\langle\psi_{0}|\psi(t)\rangle, (72) and it is easy to show that F˙(0)=0˙𝐹00\dot{F}(0)=0 and F¨(0)=(ΔH)2¨𝐹0superscriptΔ𝐻2\ddot{F}(0)=-(\Delta H)^{2}, so the energy uncertainty is a good measure of dynamics in that it also determines the fidelity evolution to lowest order, for pure states. For a detailed review of related measures of dynamics/information processing capacity, see Lloyd99 . Whimsically speaking, the dynamics principle thus implies that energy eigenstates are as unconscious as things come, and that if you know your own energy exactly, you’re dead.

Refer to caption


Figure 10: Time-evolution of Bloch vector trσρ˙1tr𝜎subscript˙𝜌1\hbox{tr}\,{\mathbf{\sigma}}\dot{\rho}_{1} for a single qubit subsystem. We saw how minimizing H3subscript𝐻3H_{3} leads to a static state with no dynamics, such as the left example. Maximizing δH𝛿𝐻\delta H, on the other hand, produces extremely simple dynamics such as the right example. Reducing δH𝛿𝐻\delta H by a modest factor of order unity can allow complex and chaotic dynamics (center); shown here is a 2-qubit system where the second qubit is traced out.

Although it is not obvious from their definitions, these quantities vmaxsubscript𝑣max{v_{\rm max}} and δH𝛿𝐻\delta H are independent of time (even though ρ𝜌\rho generally evolves). This is easily seen in the energy eigenbasis, where

iρ˙mn=[𝐇,ρ]mn=ρmn(EmEn),𝑖subscript˙𝜌𝑚𝑛subscript𝐇𝜌𝑚𝑛subscript𝜌𝑚𝑛subscript𝐸𝑚subscript𝐸𝑛-i\dot{\rho}_{mn}=[{\bf H},\rho]_{mn}=\rho_{mn}(E_{m}-E_{n}), (73)

where the energies Ensubscript𝐸𝑛E_{n} are the eigenvalues of 𝐇𝐇{\bf H}. In this basis, ρ(t)=ei𝐇tρ(0)ei𝐇t𝜌𝑡superscript𝑒𝑖𝐇𝑡𝜌0superscript𝑒𝑖𝐇𝑡\rho(t)=e^{i{\bf H}t}\rho(0)e^{-i{\bf H}t} simplifies to

ρ(t)mn=ρ(0)mnei(EmEn)t,𝜌subscript𝑡𝑚𝑛𝜌subscript0𝑚𝑛superscript𝑒𝑖subscript𝐸𝑚subscript𝐸𝑛𝑡\rho(t)_{mn}=\rho(0)_{mn}e^{i(E_{m}-E_{n})t}, (74)

This means that in the energy eigenbasis, the probabilities pnρnnsubscript𝑝𝑛subscript𝜌𝑛𝑛p_{n}\equiv\rho_{nn} are invariant over time. These quantities constitute the energy spectral density for the state:

pn=En|ρ|En.subscript𝑝𝑛quantum-operator-productsubscript𝐸𝑛𝜌subscript𝐸𝑛p_{n}=\langle E_{n}|\rho|E_{n}\rangle. (75)

In the energy eigenbasis, equation (70) reduces to

δH2=ΔH2=npnEn2(npnEn)2,𝛿superscript𝐻2Δsuperscript𝐻2subscript𝑛subscript𝑝𝑛superscriptsubscript𝐸𝑛2superscriptsubscript𝑛subscript𝑝𝑛subscript𝐸𝑛2\delta H^{2}=\Delta H^{2}=\sum_{n}p_{n}E_{n}^{2}-\left(\sum_{n}p_{n}E_{n}\right)^{2}, (76)

which is time-invariant because the spectral density pnsubscript𝑝𝑛p_{n} is. For general states, equation (69) simplifies to

δH2=mn|ρmn|2En(EnEm).𝛿superscript𝐻2subscript𝑚𝑛superscriptsubscript𝜌𝑚𝑛2subscript𝐸𝑛subscript𝐸𝑛subscript𝐸𝑚\delta H^{2}=\sum_{mn}|\rho_{mn}|^{2}E_{n}(E_{n}-E_{m}). (77)

This is time-independent because equation (74) shows that ρmnsubscript𝜌𝑚𝑛\rho_{mn} changes merely by a phase factor, leaving |ρmn|subscript𝜌𝑚𝑛|\rho_{mn}| invariant. In other words, when a quantum state evolves unitarily in the Hilbert-Schmidt vector space, both the position vector ρ𝜌\rho and the velocity vector ρ˙˙𝜌\dot{\rho} retain their lengths: both ρnorm𝜌||\rho|| and ρ˙norm˙𝜌||\dot{\rho}|| remain invariant over time.

IV.2 Dynamics versus complexity

Our results above show that if all we are interested in is maximizing the maximal probability velocity vmaxsubscript𝑣max{v_{\rm max}}, then we should find the two most widely separated eigenvalues of 𝐇𝐇{\bf H}, Eminsubscript𝐸minE_{\rm min} and Emaxsubscript𝐸maxE_{\rm max}, and choose a pure state that involves a coherent superposition of the two:

|ψ=c1|Emin+c2|Emax,ket𝜓subscript𝑐1ketsubscript𝐸minsubscript𝑐2ketsubscript𝐸max|\psi\rangle=c_{1}|E_{\rm min}\rangle+c_{2}|E_{\rm max}\rangle, (78)

where |c1|=|c2|=1/2subscript𝑐1subscript𝑐212|c_{1}|=|c_{2}|=1/\sqrt{2}. This gives δH=(EmaxEmin)/2𝛿𝐻subscript𝐸maxsubscript𝐸min2\delta H=(E_{\rm max}-E_{\rm min})/2, the largest possible value, but produces an extremely simple and boring solution ρ(t)𝜌𝑡\rho(t). Since the spectral density pn=0subscript𝑝𝑛0p_{n}=0 except for these two energies, the dynamics is effectively that of a 2-state system (a single qubit) no matter how large the dimensionality of 𝐇𝐇{\bf H} is, corresponding to a simple periodic solution with frequency ω=EmaxEmin𝜔subscript𝐸maxsubscript𝐸min\omega=E_{\rm max}-E_{\rm min} (a circular trajectory in the Bloch sphere as in the right panel of Figure 10). This violates the dynamics principle as defined in Table 2, since no substantial information processing capacity exists: the system is simply performing the trivial computation that flips a single bit repeatedly.

To perform interesting computations, the system clearly needs to exploit a significant part of its energy spectrum. As can be seen from equation (74), if the eigenvalue differences are irrational multiples of one another, then the time evolution will never repeat, and ρ𝜌\rho will eventually evolve through all parts of Hilbert space allowed by the invariants |Em|ρ|En|quantum-operator-productsubscript𝐸𝑚𝜌subscript𝐸𝑛|\langle E_{m}|\rho|E_{n}\rangle|. The reduction of δH𝛿𝐻\delta H required to transition from simple periodic motion to such complex aperiodic motion is quite modest. For example, if the eigenvalues are roughly equispaced, then changing the spectral density pnsubscript𝑝𝑛p_{n} from having all weight at the two endpoints to having approximately equal weight for all eigenvalues will only reduce the energy coherence δH𝛿𝐻\delta H by about a factor 33\sqrt{3}, since the standard deviation of a uniform distribution is 33\sqrt{3} times smaller than its half-width.

IV.3 Highly autonomous systems: sliding along the diagonal

Refer to caption

Figure 11: Schematic representation of the time-evolution of the density matrix ρijsubscript𝜌𝑖𝑗\rho_{ij} for a highly autonomous subsystem. ρij0subscript𝜌𝑖𝑗0\rho_{ij}\approx 0 except for a single region around the diagonal (red/grey dot), and this region slides along the diagonal under the influence of the subsystem Hamiltonian 𝐇1subscript𝐇1{\bf H}_{1}. Any ρijsubscript𝜌𝑖𝑗\rho_{ij}-elements far from the diagonal rapidly approach zero because of environment-decoherence caused by the interaction Hamiltonian 𝐇3subscript𝐇3{\bf H}_{3}.

What combinations of 𝐇𝐇{\bf H}, ρ𝜌\rho and factorization produce highly autonomous systems? A broad and interesting class corresponds to macroscopic objects around us that move classically to an excellent approximation.

The states that are most robust toward environment-induced decoherence are those that approximately commute with the interaction Hamiltonian ZurekHabibPaz93 . As a simple but important example, let us consider an interaction Hamiltonian of the factorizable form

𝐇3=𝐀𝐁,subscript𝐇3tensor-product𝐀𝐁{\bf H}_{3}={\bf A}\otimes{\bf B}, (79)

and work in a system basis where the interaction term 𝐀𝐀{\bf A} is diagonal. If ρ1subscript𝜌1\rho_{1} is approximately diagonal in this basis, then 𝐇3subscript𝐇3{\bf H}_{3} has little effect on the dynamics, which becomes dominated by the internal subsystem Hamiltonian 𝐇1subscript𝐇1{\bf H}_{1}. The Quantum Zeno Paradox we encountered in Section III.12 involved a situation where 𝐇1subscript𝐇1{\bf H}_{1} was also diagonal in this same basis, so that we ended up with no dynamics. As we will illustrate with examples below, classically moving objects in a sense constitute the opposite limit: the commutator ρ˙1=i[𝐇1,ρ1]subscript˙𝜌1𝑖subscript𝐇1subscript𝜌1\dot{\rho}_{1}=i[{\bf H}_{1},\rho_{1}] is essentially as large as possible instead of as small as possible, continually evading decoherence by concentrating ρ𝜌\rho around a single point that continually slides along the diagonal, as illustrated in Figure 11. Decohererence rapidly suppresses off-diagonal elements far from this diagonal, but leaves the diagonal elements completely unaffected, so there exists a low-decoherence band around the diagonal. Suppose, for instance, that our subsystem is the center-of-mass position x𝑥x of a macroscopic object experiencing a position-dependent potential V(x)𝑉𝑥V(x) caused by coupling to the environment, so that Figure 11 represents the density matrix ρ1(x,x)subscript𝜌1𝑥superscript𝑥\rho_{1}(x,x^{\prime}) in the position basis. If the potential V(x)𝑉𝑥V(x) has a flat (V=0superscript𝑉0V^{\prime}=0) bottom of width L𝐿L, then ρ1(x,x)subscript𝜌1𝑥superscript𝑥\rho_{1}(x,x^{\prime}) will be completely unaffected by decoherence for the band |xx|<Lsuperscript𝑥𝑥𝐿|x^{\prime}-x|<L. For a generic smooth potential V𝑉V, the decoherence suppression of off-diagonal elements grows only quadratically with the distance |xx|superscript𝑥𝑥|x^{\prime}-x| from the diagonal JZ85 ; brain , again making decoherence much slower than the internal dynamics in a narrow diagonal band.

As a specific example of this highly autonomous type, let us consider a subsystem with a uniformly spaced energy spectrum. Specifically, consider an n𝑛n-dimensional Hilbert space and a Hamiltonian with spectrum

Ek=[kn12]ω=kω+E0,subscript𝐸𝑘delimited-[]𝑘𝑛12Planck-constant-over-2-pi𝜔𝑘Planck-constant-over-2-pi𝜔subscript𝐸0E_{k}=\left[k-{n-1\over 2}\right]\hbar\omega=k\hbar\omega+E_{0}, (80)

k=0,1,,n1𝑘01𝑛1k=0,1,...,n-1. We will often set ω=1Planck-constant-over-2-pi𝜔1\hbar\omega=1 for simplicity. For example, n=2𝑛2n=2 gives the spectrum {12,12}1212\{-{1\over 2},{1\over 2}\} like the Pauli matrices divided by two, n=5𝑛5n=5 gives {2,1,0,1,2}21012\{-2,-1,0,1,2\} and n𝑛n\to\infty gives the simple Harmonic oscillator (since the zero-point energy is physically irrelevant, we have chosen it so that tr𝐇=Ek=0tr𝐇subscript𝐸𝑘0\hbox{tr}\,{\bf H}=\sum E_{k}=0, whereas the customary choice for the harmonic oscillator is such that the ground state energy is E0=ω/2subscript𝐸0Planck-constant-over-2-pi𝜔2E_{0}=\hbar\omega/2).

If we want to, we can define the familiar position and momentum operators x𝑥x and p𝑝p, and interpret this system as a Harmonic oscillator. However, the probability velocity v𝑣v is not maximized in either the position or the momentum basis, except twice per oscillation — when the oscillator has only kinetic energy, v𝑣v is maximized in the x𝑥x-basis, and when it has only potential energy, v𝑣v is maximized in the p𝑝p-basis, and when it has only potential energy. If we consider the Wigner function W(x,p)𝑊𝑥𝑝W(x,p), which simply rotates uniformly with frequency ω𝜔\omega, it becomes clear that the observable which is always changing with the maximal probability velocity is instead the phase, the Fourier-dual of the energy. Let us therefore define the phase operator

𝚽𝐅𝐇𝐅,𝚽superscript𝐅𝐇𝐅{\mathbf{\Phi}}\equiv{\bf F}{\bf H}{\bf F}^{\dagger}, (81)

where 𝐅𝐅{\bf F} is the unitary Fourier matrix.

Refer to caption


Figure 12: For a system with an equispaced energy spectrum (such as a truncated harmonic oscillator or a massless particle in a discrete 1-dimensional periodic space), the time-evolution has a simple geometric interpretation in the space spanned by the eigenvectors x^ksubscript^𝑥𝑘{\hat{x}_{k}} of the phase operator 𝐅𝐇𝐅𝐅𝐇𝐅{\bf F}{\bf H}{\bf F}, the Fourier dual of the Hamiltonian, corresponding to unitarily rotating the entire space with frequency ω𝜔\omega, where ωPlanck-constant-over-2-pi𝜔\hbar\omega is the energy level spacing. After a time 2π/nω2𝜋𝑛𝜔2\pi/n\omega, each basis vector has been rotated into the subsequent one, as schematically illustrated above. (The orbit in Hilbert space is only planar for n3𝑛3n\leq 3, so the figure should not be taken too literally.) The black star denotes the α=1𝛼1\alpha=1 apodized state described in the text, which is more robust toward decoherence.

Please remember that none of the systems 𝐇𝐇{\bf H} that we consider have any a priori physical interpretation; rather, the ultimate goal of the physics-from-scratch program is to derive any interpretation from the mathematics alone. Generally, any thus emergent interpretation of a subsystem will depend on its interactions with other systems. Since we have not yet introduced any interactions for our subsystem, we are free to interpret it in whichever way is convenient. In this spirit, an equivalent and sometimes more convenient way to interpret our Hamiltonian from equation (80) is as a massless one-dimensional scalar particle, for which the momentum equals the energy, so the momentum operator is 𝐩=𝐇𝐩𝐇{\bf p}={\bf H}. If we interpret the particle as existing in a discrete space with n𝑛n points and a toroidal topology (which we can think of as n𝑛n equispaced points on a ring), then the position operator is related to the momentum operator by a discrete Fourier transform:

𝐱=𝐅𝐩𝐅,Fjk1Neijk2πn.formulae-sequence𝐱superscript𝐅𝐩𝐅subscript𝐹𝑗𝑘1𝑁superscript𝑒𝑖𝑗𝑘2𝜋𝑛{\bf x}={\bf F}{\bf p}{\bf F}^{\dagger},\quad F_{jk}\equiv{1\over\sqrt{N}}e^{i{jk\over 2\pi n}}. (82)

Comparing equations (81) and  (82), we see that 𝐱=𝚽𝐱𝚽{\bf x}={\mathbf{\Phi}}. Since 𝐅𝐅{\bf F} is unitary, the operators 𝐇𝐇{\bf H}, 𝐩𝐩{\bf p}, 𝐱𝐱{\bf x} and 𝚽𝚽{\mathbf{\Phi}} all have the same spectrum: the evenly spaced grid of equation (80).

As illustrated in Figure 12, the time-evolution generated by 𝐇𝐇{\bf H} has a simple geometric interpretation in the space spanned by the position eigenstates |xkketsubscript𝑥𝑘|x_{k}\rangle, k=1,n𝑘1𝑛k=1,...n: the space is unitarily rotating with frequency ω𝜔\omega, so after a time t=2π/nω𝑡2𝜋𝑛𝜔t=2\pi/n\omega, a state |ψ(0)=|xkket𝜓0ketsubscript𝑥𝑘|\psi(0)\rangle=|x_{k}\rangle has been rotated such that it equals the next eigenvector: |ψ(t)=|xk+1ket𝜓𝑡ketsubscript𝑥𝑘1|\psi(t)\rangle=|x_{k+1}\rangle, where the addition is modulo n𝑛n. This means that the system has period T2π/ω𝑇2𝜋𝜔T\equiv 2\pi/\omega, and that |ψket𝜓|\psi\rangle rotates through each of the n𝑛n basis vectors during each period.

Let us now quantify the autonomy of this system, starting with the dynamics. Since a position eigenstate is a Dirac delta function in position space, it is a plane wave in momentum space — and in energy space, since 𝐇=𝐩𝐇𝐩{\bf H}={\bf p}. This means that the spectral density is pn=1/nsubscript𝑝𝑛1𝑛p_{n}=1/n for a position eigenstate. Substituting equation (80) into equation (76) gives an energy coherence

δH=ωn2112.𝛿𝐻Planck-constant-over-2-pi𝜔superscript𝑛2112\delta H=\hbar\omega\sqrt{n^{2}-1\over 12}. (83)

For comparison,

𝐇=(k=0n1Ek2)1/2=ωn(n21)12=nδH.norm𝐇superscriptsuperscriptsubscript𝑘0𝑛1superscriptsubscript𝐸𝑘212Planck-constant-over-2-pi𝜔𝑛superscript𝑛2112𝑛𝛿𝐻||{\bf H}||=\left(\sum_{k=0}^{n-1}E_{k}^{2}\right)^{1/2}=\hbar\omega\sqrt{n(n^{2}-1)\over 12}=\sqrt{n}\>\delta H. (84)

Let us now turn to quantifying independence and decoherence. The inner product between the unit vector |ψ(0)ket𝜓0|\psi(0)\rangle and the vector |ψ(t)ei𝐇t|ψ(0)ket𝜓𝑡superscript𝑒𝑖𝐇𝑡ket𝜓0|\psi(t)\rangle\equiv e^{i{\bf H}t}|\psi(0)\rangle into which it evolves after a time t𝑡t is

fn(ϕ)subscript𝑓𝑛italic-ϕ\displaystyle f_{n}(\phi) \displaystyle\equiv ψ|ei𝐇ϕω|ψ=1nk=0n1eiEkϕ=ein12ϕk=0n1eikϕquantum-operator-product𝜓superscript𝑒𝑖𝐇italic-ϕ𝜔𝜓1𝑛superscriptsubscript𝑘0𝑛1superscript𝑒𝑖subscript𝐸𝑘italic-ϕsuperscript𝑒𝑖𝑛12italic-ϕsuperscriptsubscript𝑘0𝑛1superscript𝑒𝑖𝑘italic-ϕ\displaystyle\langle\psi|e^{i{\bf H}{\phi\over\omega}}|\psi\rangle={1\over n}\sum_{k=0}^{n-1}e^{iE_{k}\phi}=e^{-i{n-1\over 2}\phi}\sum_{k=0}^{n-1}e^{ik\phi} (85)
=\displaystyle= 1nein12ϕ1einϕ1eiϕ=sinnϕnsinϕ,1𝑛superscript𝑒𝑖𝑛12italic-ϕ1superscript𝑒𝑖𝑛italic-ϕ1superscript𝑒𝑖italic-ϕ𝑛italic-ϕ𝑛italic-ϕ\displaystyle{1\over n}e^{-i{n-1\over 2}\phi}{1-e^{in\phi}\over 1-e^{i\phi}}={\sin n\phi\over n\sin\phi},

where ϕωtitalic-ϕ𝜔𝑡\phi\equiv\omega t. This inner product fnsubscript𝑓𝑛f_{n} is plotted in Figure 13, and is seen to be a sharply peaked even function satisfying fn(0)=1subscript𝑓𝑛01f_{n}(0)=1, fn(2πk/n)=0subscript𝑓𝑛2𝜋𝑘𝑛0f_{n}(2\pi k/n)=0 for k=1,,n1𝑘1𝑛1k=1,...,n-1 and exhibiting one small oscillation between each of these zeros. The angle θcos1fn(ϕ)𝜃superscript1subscript𝑓𝑛italic-ϕ\theta\equiv\cos^{-1}f_{n}(\phi) between an initial vector ϕitalic-ϕ\phi and its time evolution thus grows rapidly from 0superscript00^{\circ} to 90superscript9090^{\circ}, then oscillates close to 90superscript9090^{\circ} until returning to 0superscript00^{\circ} after a full period T𝑇T. An initial state |ψ(0)=|xkket𝜓0ketsubscript𝑥𝑘|\psi(0)\rangle=|x_{k}\rangle therefore evolves as

ψj(t)=fn(ωt2π[jk]/n)subscript𝜓𝑗𝑡subscript𝑓𝑛𝜔𝑡2𝜋delimited-[]𝑗𝑘𝑛\psi_{j}(t)=f_{n}(\omega t-2\pi[j-k]/n)

in the position basis, i.e., a wavefunction ψjsubscript𝜓𝑗\psi_{j} sharply peaked for jk+nωt/2πsimilar-to𝑗𝑘𝑛𝜔𝑡2𝜋j\sim k+n\omega t/2\pi (mod n𝑛n). Since the density matrix evolves as ρij(t)=ψi(t)ψj(t)subscript𝜌𝑖𝑗𝑡subscript𝜓𝑖𝑡subscript𝜓𝑗superscript𝑡\rho_{ij}(t)=\psi_{i}(t)\psi_{j}(t)^{*}, it will therefore be small except for ijk+nωt/2πsimilar-to𝑖𝑗similar-to𝑘𝑛𝜔𝑡2𝜋i\sim j\sim k+n\omega t/2\pi (mod n𝑛n), corresponding to the round dot on the diagonal in Figure 11. In particular, the decoherence-sensitive elements ρjksubscript𝜌𝑗𝑘\rho_{jk} will be small far from the diagonal, corresponding to the small values that fnsubscript𝑓𝑛f_{n} takes far from zero. How small will the decoherence be? Let us now develop the tools needed to quantify this.

Refer to caption

Figure 13: The wiggliest (heavy black) curve shows the inner product of a position eigenstate with what it evolves into a time t=ϕ/ω𝑡italic-ϕ𝜔t=\phi/\omega later due to our n=20𝑛20n=20-dimensional Hamiltonian with energy spacings ωPlanck-constant-over-2-pi𝜔\hbar\omega. When optimizing to minimize the square of this curve using the 1cosϕ1italic-ϕ1-\cos\phi penalty function shown, corresponding to apodization in the Fourier domain, we instead obtain the green/light grey curve, resulting in much less decoherence.

IV.4 The exponential growth of autonomy with system size

Let us return to the most general Hamiltonian 𝐇𝐇{\bf H} and study how an initially separable state ρ=ρ1ρ2𝜌tensor-productsubscript𝜌1subscript𝜌2\rho=\rho_{1}\otimes\rho_{2} evolves over time. Using the orthogonal projectors of Section III.9, we can decompose 𝐇𝐇{\bf H} as

𝐇=𝐇1𝐈+𝐈𝐇2+𝐇3,𝐇tensor-productsubscript𝐇1𝐈tensor-product𝐈subscript𝐇2subscript𝐇3{\bf H}={\bf H}_{1}\otimes{\bf I}+{\bf I}\otimes{\bf H}_{2}+{\bf H}_{3}, (86)

where tr1𝐇3=tr2𝐇3=0subscripttr1subscript𝐇3subscripttr2subscript𝐇30\hbox{tr}\,_{1}{\bf H}_{3}=\hbox{tr}\,_{2}{\bf H}_{3}=0. By substituting equation (86) into the evolution equation ρ˙1=tr2ρ˙=itr2[𝐇,ρ]subscript˙𝜌1subscripttr2˙𝜌𝑖subscripttr2𝐇𝜌\dot{\rho}_{1}=\hbox{tr}\,_{2}\dot{\rho}=i\hbox{tr}\,_{2}[{\bf H},\rho] and using various partial trace identities from Section A to simplify the resulting three terms, we obtain

ρ˙1=itr2[𝐇,ρ1ρ2]=i[𝐇1+𝐇,ρ1],subscript˙𝜌1𝑖subscripttr2𝐇tensor-productsubscript𝜌1subscript𝜌2𝑖subscript𝐇1subscript𝐇subscript𝜌1\dot{\rho}_{1}=i\,\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf H},\rho_{1}\otimes\rho_{2}]=i\,[{\bf H}_{1}+{\bf H}_{*},\rho_{1}], (87)

where what we will term the effective interaction Hamiltonian

𝐇tr2{(𝐈ρ2)𝐇3}subscript𝐇subscripttr2tensor-product𝐈subscript𝜌2subscript𝐇3{\bf H}_{*}\equiv\operatornamewithlimits{\hbox{tr}\,}_{2}\{({\bf I}\otimes\rho_{2}){\bf H}_{3}\} (88)

can be interpreted as an average of the interaction Hamiltonian 𝐇3subscript𝐇3{\bf H}_{3}, weighted by the environment state ρ2subscript𝜌2\rho_{2}. A similar effective Hamiltonian is studied in Omnes01 ; Gemmer01 ; Durt04 . Equation (87) implies that the evolution of ρ1subscript𝜌1\rho_{1} remains unitary to first order in time, the only effect of the interaction 𝐇3subscript𝐇3{\bf H}_{3} being to replace 𝐇1subscript𝐇1{\bf H}_{1} from equation (15) by an effective Hamiltonian 𝐇1+𝐇subscript𝐇1subscript𝐇{\bf H}_{1}+{\bf H}_{*}.

The second time derivative is given by ρ¨1=tr2ρ˙=tr2[𝐇,[𝐇,ρ]]subscript¨𝜌1subscripttr2˙𝜌subscripttr2𝐇𝐇𝜌\ddot{\rho}_{1}=\hbox{tr}\,_{2}\dot{\rho}=-\hbox{tr}\,_{2}[{\bf H},[{\bf H},\rho]], and by analogously substituting equation (86) and using partial trace identities from Section A to simplify the resulting nine terms, we obtain

ρ¨1subscript¨𝜌1\displaystyle-\ddot{\rho}_{1} =\displaystyle= tr2[𝐇,[𝐇,ρ1ρ2]]=subscripttr2𝐇𝐇tensor-productsubscript𝜌1subscript𝜌2absent\displaystyle\,\hbox{tr}\,_{2}[{\bf H},[{\bf H},\rho_{1}\otimes\rho_{2}]]= (89)
=\displaystyle= [𝐇1,[𝐇1,ρ1]]i[𝐊,ρ1]+subscript𝐇1subscript𝐇1subscript𝜌1limit-from𝑖𝐊subscript𝜌1\displaystyle[{\bf H}_{1},[{\bf H}_{1},\rho_{1}]]-i\,[{\bf K},\rho_{1}]+
+\displaystyle+ [𝐇1,[𝐇,ρ1]]+[𝐇,[𝐇1,ρ1]]+subscript𝐇1subscript𝐇subscript𝜌1limit-fromsubscript𝐇subscript𝐇1subscript𝜌1\displaystyle[{\bf H}_{1},[{\bf H}_{*},\rho_{1}]]+[{\bf H}_{*},[{\bf H}_{1},\rho_{1}]]+
+\displaystyle+ tr2[𝐇3,[𝐇3,ρ1ρ2]],subscripttr2subscript𝐇3subscript𝐇3tensor-productsubscript𝜌1subscript𝜌2\displaystyle\hbox{tr}\,_{2}[{\bf H}_{3},[{\bf H}_{3},\rho_{1}\otimes\rho_{2}]],

where we have defined the Hermitian matrix

𝐊itr2{(𝐈[𝐇2,ρ2])𝐇3}.𝐊𝑖subscripttr2tensor-product𝐈subscript𝐇2subscript𝜌2subscript𝐇3{\bf K}\equiv i\,\hbox{tr}\,_{2}\{({\bf I}\otimes[{\bf H}_{2},\rho_{2}]){\bf H}_{3}\}. (90)

To qualify independence and autonomy, we are interested in the extent to which 𝐇3subscript𝐇3{\bf H}_{3} causes entanglement and makes the time-evolution of ρ1subscript𝜌1\rho_{1} non-unitary. When thinking of ρ𝜌\rho as a vector in the Hilbert-Schmidt vector space that we reviewed in Section III.8, unitary evolution preserves its length ρnorm𝜌||\rho||. To provide geometric intuition for this, let us define dot and cross product notation analogous to vector calculus. First note that

(𝐀,[𝐀,𝐁])=tr𝐀𝐀𝐁tr𝐀𝐁𝐀=0,superscript𝐀𝐀𝐁tr𝐀𝐀𝐁tr𝐀𝐁𝐀0({\bf A}^{\dagger},[{\bf A},{\bf B}])=\hbox{tr}\,{\bf A}{\bf A}{\bf B}-\hbox{tr}\,{\bf A}{\bf B}{\bf A}=0, (91)

since a trace of a product is invariant under cyclic permutations of the factors. This shows that a commutator [𝐀,𝐁]𝐀𝐁[{\bf A},{\bf B}] is orthogonal to both 𝐀superscript𝐀{\bf A}^{\dagger} and 𝐁superscript𝐁{\bf B}^{\dagger} under the Hilbert-Schmidt inner product, and a Hermitian matrix 𝐇𝐇{\bf H} is orthogonal to its commutator with any matrix.

This means that it we restrict ourselves to the Hilbert-Schmidt vector space of Hermitian matrices, we obtain an interesting generalization of the standard dot and cross products for 3D vectors. Defining

𝐀𝐁𝐀𝐁\displaystyle{\bf A}\cdot{\bf B} \displaystyle\equiv (𝐀,𝐁),𝐀𝐁\displaystyle({\bf A},{\bf B}), (92)
𝐀×𝐁𝐀𝐁\displaystyle\ {\bf A}\times{\bf B} \displaystyle\equiv i[𝐀,𝐁],𝑖𝐀𝐁\displaystyle i[{\bf A},{\bf B}], (93)

we see that these operations satisfy all the same properties as their familiar 3D analogs: the scalar (dot) product is symmetric (𝐁𝐀=tr𝐁𝐀=tr𝐀𝐁=𝐀𝐁){\bf B}\cdot{\bf A}=\hbox{tr}\,{\bf B}^{\dagger}{\bf A}=\hbox{tr}\,{\bf A}{\bf B}^{\dagger}={\bf A}\cdot{\bf B}), while the vector (cross) product is antisymmetric (𝐀×𝐁=𝐁×𝐀𝐀𝐁𝐁𝐀{\bf A}\times{\bf B}={\bf B}\times{\bf A}), orthogonal to both factors ([𝐀×𝐁]𝐀=[𝐀×𝐁]𝐁=0delimited-[]𝐀𝐁𝐀delimited-[]𝐀𝐁𝐁0[{\bf A}\times{\bf B}]\cdot{\bf A}=[{\bf A}\times{\bf B}]\cdot{\bf B}=0), and produces a result of the same type as the two factors (a Hermitian matrix).

In this notation, the products of an arbitrary Hermitian matrix 𝐀𝐀{\bf A} with the identity matrix 𝐈𝐈{\bf I} are

𝐈𝐀𝐈𝐀\displaystyle{\bf I}\cdot{\bf A} =\displaystyle= tr𝐀,tr𝐀\displaystyle\hbox{tr}\,{\bf A}, (94)
𝐈×𝐀𝐈𝐀\displaystyle{\bf I}\times{\bf A} =\displaystyle= 0,0\displaystyle 0, (95)

and the Schrödinger equation ρ˙=i[𝐇,ρ]˙𝜌𝑖𝐇𝜌\dot{\rho}=i[{\bf H},\rho] becomes simply

ρ˙=𝐇×ρ.˙𝜌𝐇𝜌\dot{\rho}={\bf H}\times\rho. (96)

Just as in the 3D vector analogy, we can think of this as generating rotation of the vector ρ𝜌\rho that preserves its length:

ddtρ2=ddtρρ=2ρ˙ρ=2(𝐇×ρ)ρ=0.𝑑𝑑𝑡superscriptnorm𝜌2𝑑𝑑𝑡𝜌𝜌2˙𝜌𝜌2𝐇𝜌𝜌0{d\over dt}||\rho||^{2}={d\over dt}\rho\cdot\rho=2\dot{\rho}\cdot\rho=2({\bf H}\times\rho)\cdot\rho=0. (97)

A simple and popular way of quantifying whether evolution is non-unitary is to compute the linear entropy

Slin1trρ2=1ρ2,superscript𝑆lin1trsuperscript𝜌21superscriptnorm𝜌2S^{\rm lin}\equiv 1-\hbox{tr}\,\rho^{2}=1-||\rho||^{2}, (98)

and repeatedly differentiating equation (98) tells us that

S˙linsuperscript˙𝑆lin\displaystyle{\dot{S}}^{\rm lin} =\displaystyle= 2ρρ˙,2𝜌˙𝜌\displaystyle-2\rho\cdot\dot{\rho}, (99)
S¨linsuperscript¨𝑆lin\displaystyle{\ddot{S}}^{\rm lin} =\displaystyle= 2(ρ˙2+ρρ¨),2superscriptnorm˙𝜌2𝜌¨𝜌\displaystyle-2(||\dot{\rho}||^{2}+\rho\cdot\ddot{\rho}), (100)
S˙˙˙linsuperscript˙˙˙𝑆lin\displaystyle{\dddot{S}}^{\rm lin} =\displaystyle= 6ρ˙ρ¨2ρρ˙˙˙.6˙𝜌¨𝜌2𝜌˙˙˙𝜌\displaystyle-6\dot{\rho}\cdot\ddot{\rho}-2\rho\cdot\dddot{\rho}. (101)

Substituting equations (87) and (89) into equations (99) and (100) for ρ1subscript𝜌1\rho_{1}, we find that almost all terms cancel, leaving us with the simple result

S˙1linsubscriptsuperscript˙𝑆lin1\displaystyle{\dot{S}}^{\rm lin}_{1} =\displaystyle= 0,0\displaystyle 0, (102)
S¨1linsubscriptsuperscript¨𝑆lin1\displaystyle{\ddot{S}}^{\rm lin}_{1} =\displaystyle= 2tr{ρ1tr2[𝐇3,[𝐇3,ρ]]}2[𝐇,ρ1]2.2trsubscript𝜌1subscripttr2subscript𝐇3subscript𝐇3𝜌2superscriptnormsubscript𝐇subscript𝜌12\displaystyle 2\,\hbox{tr}\,\{\rho_{1}\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf H}_{3},[{\bf H}_{3},\rho]]\}-2||[{\bf H}_{*},\rho_{1}]||^{2}. (103)

This means that, to second order in time, the entropy production is completely independent of 𝐇1subscript𝐇1{\bf H}_{1} and 𝐇2subscript𝐇2{\bf H}_{2}, depending only on quadratic combinations of 𝐇3subscript𝐇3{\bf H}_{3}, weighted by quadratic combinations of ρ𝜌\rho. We find analogous results for the Shannon entropy S𝑆S: If the density matrix is initially separable, then S˙1=0subscript˙𝑆10\dot{S}_{1}=0 and S¨1subscript¨𝑆1\ddot{S}_{1} depends not on the full Hamiltonian 𝐇𝐇{\bf H}, but only on its non-separable component 𝐇3subscript𝐇3{\bf H}_{3}, quadratically.

We now have the tools we need to compute the autonomy of our “diagonal-sliding” system from the previous subsection. As a simple example, let us take 𝐇1subscript𝐇1{\bf H}_{1} to be our Hamiltonian from equation (80) with its equispaced energy spectrum, with n=2b𝑛superscript2𝑏n=2^{b}, so that we can view the Hilbert space as that of b𝑏b coupled qubits. Equation (83) then gives an energy coherence

δHω12 2b,𝛿𝐻Planck-constant-over-2-pi𝜔12superscript2𝑏\delta H\approx{\hbar\omega\over\sqrt{12}}\>2^{b}, (104)

so the probability velocity grows exponentially with the system size b𝑏b.

We augment this Hilbert space with one additional “environment” qubit that begins in the state |ket|\!\!\uparrow\rangle, with internal dynamics given by 𝐇2=ω2σxsubscript𝐇2Planck-constant-over-2-pisubscript𝜔2subscript𝜎𝑥{\bf H}_{2}=\hbar\omega_{2}\sigma_{x}, and couple it to our subsystem with an interaction

𝐇3=V(𝐱)σxsubscript𝐇3tensor-product𝑉𝐱subscript𝜎𝑥{\bf H}_{3}=V({\bf x})\otimes\sigma_{x} (105)

for some potential V𝑉V; x𝑥x is the position operator from equation (82). As a first example, we use the sinusoidal potential V(𝐱)=sin(2π𝐱/n)𝑉𝐱2𝜋𝐱𝑛V({\bf x})=\sin(2\pi{\bf x}/n), start the first subsystem in the position eigenstate |x1ketsubscript𝑥1|x_{1}\rangle and compute the linear entropy S1lin(t)subscriptsuperscript𝑆lin1𝑡S^{\rm lin}_{1}(t) numerically.

As expected from our qualitative arguments of the previous section, S1lin(t)subscriptsuperscript𝑆lin1𝑡S^{\rm lin}_{1}(t) grows only very slowly, and we find that it can be accurately approximated by its Taylor expansion around t=0𝑡0t=0 for many orbital periods T2π/ω𝑇2𝜋𝜔T\equiv 2\pi/\omega: S1lin(t)S¨1lin(0)t2/2subscriptsuperscript𝑆lin1𝑡subscriptsuperscript¨𝑆lin10superscript𝑡22S^{\rm lin}_{1}(t)\approx\ddot{S}^{\rm lin}_{1}(0)\,t^{2}/2, where S¨1lin(0)subscriptsuperscript¨𝑆lin10\ddot{S}^{\rm lin}_{1}(0) is given by equation (103). Figure 14 shows the linear entropy after one orbit, S1lin(T)subscriptsuperscript𝑆lin1𝑇S^{\rm lin}_{1}(T), as a function of the number of qubits b𝑏b in our subsystem (top curve in top panel). Whereas equation (105) showed that the dynamics increases exponentially with system size (as 2bsuperscript2𝑏2^{b}), the figure shows that S1lin(T)subscriptsuperscript𝑆lin1𝑇S^{\rm lin}_{1}(T) decreases exponentially with system size, asymptotically falling as 24bsuperscript24𝑏2^{-4b} as b𝑏b\to\infty.

Let us define the dynamical timescale τdynsubscript𝜏dyn\tau_{\rm dyn} and the independence timescale τindsubscript𝜏ind\tau_{\rm ind} as

τdynsubscript𝜏dyn\displaystyle\tau_{\rm dyn} =\displaystyle= δH,Planck-constant-over-2-pi𝛿𝐻\displaystyle{\hbar\over\delta H}, (106)
τindsubscript𝜏ind\displaystyle\tau_{\rm ind} =\displaystyle= [S¨1lin(0)]1/2.superscriptdelimited-[]subscriptsuperscript¨𝑆lin1012\displaystyle[\ddot{S}^{\rm lin}_{1}(0)]^{-1/2}. (107)

Loosely speaking, we can think of τdynsubscript𝜏dyn\tau_{\rm dyn} as the time our system requires to perform an elementary information processing operation such as a bit flip Lloyd99 , and τindsubscript𝜏ind\tau_{\rm ind} as the time it takes for the linear entropy to change by of order unity, i.e., for significant information exchange with the environment to occur. If we define the autonomy A𝐴A as the ratio

Aτindτdyn,𝐴subscript𝜏indsubscript𝜏dynA\equiv{\tau_{\rm ind}\over\tau_{\rm dyn}}, (108)

the autonomy of our subsystem thus grows exponentially with system size, asymptotically increasing as A22b/2b=23bproportional-to𝐴superscript22𝑏superscript2𝑏superscript23𝑏A\propto 2^{2b}/2^{-b}=2^{3b} as b𝑏b\to\infty.

As illustrated by Figure 11, we expect this exponential scaling to be quite generic, independent of interaction details: the origin of the exponential is simply that the size of the round dot in the figure is of order 2bsuperscript2𝑏2^{b} times smaller than the size of the square representing the full density matrix. The independence timescale τindsubscript𝜏ind\tau_{\rm ind} is exponentially large because the dot, with its non-negligible elements ρijsubscript𝜌𝑖𝑗\rho_{ij}, is exponentially close to the diagonal. The dynamics timescale τdynsubscript𝜏dyn\tau_{\rm dyn} is exponentially small because it is roughly the time it takes the dot to traverse its own diameter as it moves around at some b𝑏b-independent speed in the figure.

This exponential increase of autonomy with system size makes it very easy to have highly autonomous systems even if the magnitude H3subscript𝐻3H_{3} of the interaction Hamiltonian is quite large. Although the environment continually “measures” the position of the subsystem through the strong coupling 𝐇3subscript𝐇3{\bf H}_{3}, this measurement does not decohere the subsystem because it is (to an exponentially good approximation) a non-demolition measurement, with the subsystem effectively in a position eigenstate. This phenomenon is intimately linked to the quantum Darwinism paradigm developed by Zurek and collaborators Zurek09 , where the environment mediates the emergence of a classical world by acting as a witness, storing large numbers of redundant copies of information about the system state in the basis that it measures. We thus see that systems that have high autonomy via the “diagonal-sliding” mechanism are precisely objects that dominate quantum Darwinism’s “survival of the fittest” by proliferating imprints of their states in the environment.

Refer to caption

Figure 14: The linear entropy increase during the first orbit, S¨1lin(2π/ω)superscriptsubscript¨𝑆1lin2𝜋𝜔{\ddot{S}}_{1}^{\rm lin}(2\pi/\omega), is plotted for as a function of the subsystem size (number of qubits b𝑏b). The interaction potential V(x)𝑉𝑥V(x) is sinusoidal (top) and Gaussian (bottom), and the different apodization schemes used to select the initial state are labeled by their corresponding α𝛼\alpha-value, where α=0𝛼0\alpha=0 corresponds to no apodization (the initial state being a position eigenstate). Some lines have been terminated in the bottom panel due to insufficient numerical precision.

IV.5 Boosting autonomy with optimized wave packets

In our worked example above, we started our subsystem in a position eigenstate |x1ketsubscript𝑥1|x_{1}\rangle, which cyclically evolved though all other position eigenstates. The slight decoherence that did occur thus originated during the times when the state was between eigenstates, in a coherent superpositions of multiple eigenstates quantified by the most wiggly curve in Figure 13. Not surprisingly, these wiggles (and hence the decoherence) can be reduced by a better choice of initial state |ψ=kψk|xk=kψ^k|Ekket𝜓subscript𝑘subscript𝜓𝑘ketsubscript𝑥𝑘subscript𝑘subscript^𝜓𝑘ketsubscript𝐸𝑘|\psi\rangle=\sum_{k}\psi_{k}|x_{k}\rangle=\sum_{k}\hat{\psi}_{k}|E_{k}\rangle for our subsystem, where ψksubscript𝜓𝑘\psi_{k} and ψ^ksubscript^𝜓𝑘\hat{\psi}_{k} are the wavefunction amplitudes in the position and energy bases, respectively. Equation (85) then gets generalized to

gn(ϕ)x1|ei𝐇ϕω|ψ=ein12ϕk=0n1ψ^keikϕ.subscript𝑔𝑛italic-ϕquantum-operator-productsubscript𝑥1superscript𝑒𝑖𝐇italic-ϕ𝜔𝜓superscript𝑒𝑖𝑛12italic-ϕsuperscriptsubscript𝑘0𝑛1subscript^𝜓𝑘superscript𝑒𝑖𝑘italic-ϕg_{n}(\phi)\equiv\langle x_{1}|e^{i{\bf H}{\phi\over\omega}}|\psi\rangle=e^{-i{n-1\over 2}\phi}\sum_{k=0}^{n-1}\hat{\psi}_{k}e^{ik\phi}. (109)

Let us choose the initial state |ψket𝜓|\psi\rangle that minimizes the quantity

ππ|gn(θ)|2w(θ)𝑑θsuperscriptsubscript𝜋𝜋superscriptsubscript𝑔𝑛𝜃2𝑤𝜃differential-d𝜃\int_{-\pi}^{\pi}|g_{n}(\theta)|^{2}w(\theta)d\theta (110)

for some penalty function w(θ)𝑤𝜃w(\theta) that punishes states giving large unwanted |g(θ)|𝑔𝜃|g(\theta)| far from θ=0𝜃0\theta=0. This gives a simple quadratic minimization problem for the vector of coefficients ψ^ksubscript^𝜓𝑘\hat{\psi}_{k}, whose solution turns out to be the last (with smallest eigenvalue) eigenvector of the Toeplitz matrix whose first row is the Fourier series of w(θ)𝑤𝜃w(\theta). A convenient choice of penalty function 1cosϕ1italic-ϕ1-\cos\phi (see Figure 13), which respects the periodicity of the problem and grows quadratically around its ϕ=0italic-ϕ0\phi=0 minimum. In the n𝑛n\to\infty limit, the Toeplitz eigenvalue problem simplifies to Laplace’s equation with a ψ^(ϕ)=cosϕ2^𝜓italic-ϕitalic-ϕ2\hat{\psi}(\phi)=\cos{\phi\over 2} winning eigenvector, giving

ψkππcos(kϕ)ϕ^(ϕ)𝑑ϕ=cos(πk)14k2.subscript𝜓𝑘superscriptsubscript𝜋𝜋𝑘italic-ϕ^italic-ϕitalic-ϕdifferential-ditalic-ϕ𝜋𝑘14superscript𝑘2\psi_{k}\equiv\int_{-\pi}^{\pi}\cos(k\phi)\hat{\phi}(\phi)d\phi={\cos(\pi k)\over 1-4k^{2}}. (111)

The corresponding curve gn(ϕ)subscript𝑔𝑛italic-ϕg_{n}(\phi) is plotted is Figure 13, and is seen to have significantly smaller wiggles away from the origin at the cost of a very slight widening of the central peak. Figure 14 (top panel, lower curve) shows that this choice significantly reduces decoherence.

What we have effectively done is employ the standard signal processing technique known as apodization. Aside from the irrelevant phase factor, equation (109) is simply the Fourier transform of ψ^^𝜓\hat{\psi}, which can be made narrower by making ψ^^𝜓\hat{\psi} smoothly approach zero at the two endpoints. In the n𝑛n\to\infty limit, our original choice corresponded to ψ^=1^𝜓1\hat{\psi}=1 for πϕπ𝜋italic-ϕ𝜋-\pi\leq\phi\leq\pi, which is discontinuous, whereas our replacement function ψ^=cosϕ2^𝜓italic-ϕ2\hat{\psi}=\cos{\phi\over 2} vanishes at the endpoints and is continuous. This reduces the wiggling because Riemann-Lebesgue’s lemma implies that the Fourier transform of a function whose first d𝑑d derivatives are continuous falls off faster than kdsuperscript𝑘𝑑k^{-d}. By instead using ψ^(α)(ϕ)=(cosϕ2)αsuperscript^𝜓𝛼italic-ϕsuperscriptitalic-ϕ2𝛼\hat{\psi}^{(\alpha)}(\phi)=(\cos{\phi\over 2})^{\alpha} for some integer α0𝛼0\alpha\geq 0, we get α𝛼\alpha continuous derivatives, so the larger we choose α𝛼\alpha, the smaller the decoherence-inducing wiggles, at the cost of widening the central peak. The first five cases give

ψk(0)subscriptsuperscript𝜓0𝑘\displaystyle\psi^{(0)}_{k} =\displaystyle= δ0k,subscript𝛿0𝑘\displaystyle\delta_{0k}, (112)
ψk(1)subscriptsuperscript𝜓1𝑘\displaystyle\psi^{(1)}_{k} =\displaystyle= cos(πk)14k2,𝜋𝑘14superscript𝑘2\displaystyle{\cos(\pi k)\over 1-4k^{2}}, (113)
ψk(2)subscriptsuperscript𝜓2𝑘\displaystyle\psi^{(2)}_{k} =\displaystyle= δ0k+12δ1,|k|,subscript𝛿0𝑘12subscript𝛿1𝑘\displaystyle\delta_{0k}+{1\over 2}\delta_{1,|k|}, (114)
ψk(3)subscriptsuperscript𝜓3𝑘\displaystyle\psi^{(3)}_{k} =\displaystyle= cos(πk)(14k2)(149k2),𝜋𝑘14superscript𝑘2149superscript𝑘2\displaystyle{\cos(\pi k)\over(1-4k^{2})(1-{4\over 9}k^{2})}, (115)
ψk(4)subscriptsuperscript𝜓4𝑘\displaystyle\psi^{(4)}_{k} =\displaystyle= δ0k+23δ1,|k|+16δ2,|k|,subscript𝛿0𝑘23subscript𝛿1𝑘16subscript𝛿2𝑘\displaystyle\delta_{0k}+{2\over 3}\delta_{1,|k|}+{1\over 6}\delta_{2,|k|}, (116)

and it is easy to show that the α𝛼\alpha\to\infty limit corresponds to a Gaussian shape.

Which apodization is best? This depends on the interaction 𝐇3subscript𝐇3{\bf H}_{3}. For our sinusoidal interaction potential (Figure 14, top), the best results are for α=1𝛼1\alpha=1, when the penalty function has a quadratic minimum. When switching to the roughly Gaussian interaction potential V(𝐱)e4cos(2π𝐱/n)proportional-to𝑉𝐱superscript𝑒42𝜋𝐱𝑛V({\bf x})\propto e^{4}\cos(2\pi{\bf x}/n) (Figure 14, bottom), the results are instead seen to keep improving as we increase α𝛼\alpha, producing dramatically less decoherence than for the sinusoidal potential, and suggesting that the optical choice is the α𝛼\alpha\to\infty state: a Gaussian wave packet. Gaussian wave packets have long garnered interest as models of approximately classical states. They correspond to generalized coherent states, which have shown to be maximally robust toward decoherence in important situations involving harmonic oscillator interactions ZHP93 . They have also been shown to emerge dynamically in harmonic oscillator environments, from the accumulation of many independent interactions, in much the same way as the central limit theorem gives a Gaussian probability distribution to sums of many independent contributions gaussians . Our results suggest that Gaussian wave packets may also emerge as the most robust states towards decoherence from short-range interactions with exponential fall-off.

IV.6 Optimizing autonomy when we can choose the state: factorizable effective theories

Above we explored specific examples of highly autonomous systems, motivated by approximately classical systems that we find around us in nature. We found that there are combinations of ρ𝜌\rho, 𝐇𝐇{\bf H} and Hilbert space factorization that provide excellent autonomy even when the interaction H3subscript𝐻3H_{3} is not small. We will now see that, more generally, given any 𝐇𝐇{\bf H} and factorization, there are states ρ𝜌\rho that give perfect factorization and infinite autonomy. The basic idea is that for states such that some of the spectral density invariants pksubscript𝑝𝑘p_{k} vanish, it makes no difference if we replace the corresponding unused eigenvalues of 𝐇𝐇{\bf H} by others to make the Hamiltonian separable.

Consider a subspace of the full Hilbert space defined by a projection operator 𝚷𝚷{\mathbf{\Pi}}. A projection operator satisfies 𝚷2=𝚷=𝚷superscript𝚷2𝚷superscript𝚷{\mathbf{\Pi}}^{2}={\mathbf{\Pi}}={\mathbf{\Pi}}^{\dagger}, so its eigenvalues are all zero or one, and the latter correspond to our subspace of interest. Let us define the symbol difference-between\bumpeq to denote that operator equality holds in this subspace. For example,

𝐀𝐁0difference-between𝐀𝐁0{\bf A}-{\bf B}\bumpeq 0 (117)

means that

𝚷(𝐀𝐁)𝚷=0.𝚷𝐀𝐁𝚷0{\mathbf{\Pi}}({\bf A}-{\bf B}){\mathbf{\Pi}}=0. (118)

Below will often chose the subspace to correspond to low-energy states, so the wave symbol in difference-between\bumpeq is intended to remind us that equality holds in the long wavelength limit.

We saw that the energy spectral density pnsubscript𝑝𝑛p_{n} of equation (75) remains invariant under unitary time evolution, so any energy levels for which pn=0subscript𝑝𝑛0p_{n}=0 will never have any physical effect, and the corresponding dimensions of the Hilbert space can simply be ignored as “frozen out”. This remains true even considering observation-related state projection as described in the next subsection. Let us therefore define

𝚷=kθ(pn)|EnEn|,𝚷subscript𝑘𝜃subscript𝑝𝑛ketsubscript𝐸𝑛brasubscript𝐸𝑛{\mathbf{\Pi}}=\sum_{k}\theta(p_{n})|E_{n}\rangle\langle E_{n}|, (119)

where θ𝜃\theta is the Heaviside step function (θ(x)=1𝜃𝑥1\theta(x)=1 if x>0𝑥0x>0, vanishing otherwise) i.e., summing only over those energy eigenstates for which the probability pnsubscript𝑝𝑛p_{n} is non-zero. Defining new operators in our subspace by

ρsuperscript𝜌\displaystyle\rho^{\prime} \displaystyle\equiv 𝚷ρ𝚷,𝚷𝜌𝚷\displaystyle{\mathbf{\Pi}}\rho{\mathbf{\Pi}}, (120)
𝐇superscript𝐇\displaystyle{\bf H}^{\prime} \displaystyle\equiv 𝚷𝐇𝚷,𝚷𝐇𝚷\displaystyle{\mathbf{\Pi}}{\bf H}{\mathbf{\Pi}}, (121)

equation (119) implies that

ρsuperscript𝜌\displaystyle\rho^{\prime} =\displaystyle= mnθ(pm)θ(pn)|EmEm|ρ|EnEn|subscript𝑚𝑛𝜃subscript𝑝𝑚𝜃subscript𝑝𝑛ketsubscript𝐸𝑚quantum-operator-productsubscript𝐸𝑚𝜌subscript𝐸𝑛brasubscript𝐸𝑛\displaystyle\sum_{mn}\theta(p_{m})\theta(p_{n})|E_{m}\rangle\langle E_{m}|\rho|E_{n}\rangle\langle E_{n}| (123)
=\displaystyle= mn|EmEm|ρ|EnEn|=ρ,subscript𝑚𝑛ketsubscript𝐸𝑚quantum-operator-productsubscript𝐸𝑚𝜌subscript𝐸𝑛brasubscript𝐸𝑛𝜌\displaystyle\sum_{mn}|E_{m}\rangle\langle E_{m}|\rho|E_{n}\rangle\langle E_{n}|=\rho,

Here the second equal sign follows from the fact that |Em|ρ|En|2Em|ρ|EmEn|ρ|Ensuperscriptquantum-operator-productsubscript𝐸𝑚𝜌subscript𝐸𝑛2quantum-operator-productsubscript𝐸𝑚𝜌subscript𝐸𝑚quantum-operator-productsubscript𝐸𝑛𝜌subscript𝐸𝑛|\langle E_{m}|\rho|E_{n}\rangle|^{2}\leq\langle E_{m}|\rho|E_{m}\rangle\langle E_{n}|\rho|E_{n}\rangle141414This last inequality follows because ρ𝜌\rho is Hermitian and positive semidefinite, so the determinant must be non-negative for the 2×2222\times 2 matrix Ei|ρ|Ejquantum-operator-productsubscript𝐸𝑖𝜌subscript𝐸𝑗\langle E_{i}|\rho|E_{j}\rangle where i𝑖i and j𝑗j each take the two values k𝑘k and l𝑙l. , so that the left hand side must vanish whenever either pmsubscript𝑝𝑚p_{m} or pnsubscript𝑝𝑛p_{n} vanishes — the Heaviside step functions therefore have no effect in equation (123) and can be dropped.

Although 𝐇𝐇superscript𝐇𝐇{\bf H}^{\prime}\neq{\bf H}, we do have 𝐇𝐇difference-betweensuperscript𝐇𝐇{\bf H}^{\prime}\bumpeq{\bf H}, and this means that the time-evolution of ρ𝜌\rho can be correctly computed using 𝐇superscript𝐇{\bf H}^{\prime} in place of the full Hamiltonian 𝐇𝐇{\bf H}:

ρ(t)=𝚷ρ(t)𝚷=𝚷𝐞i𝐇t𝚷ρ(0)𝚷ei𝐇t𝚷=ei𝐇tρ(0)ei𝐇t.𝜌𝑡𝚷𝜌𝑡𝚷𝚷superscript𝐞𝑖𝐇𝑡𝚷𝜌0𝚷superscript𝑒𝑖𝐇𝑡𝚷superscript𝑒𝑖superscript𝐇𝑡𝜌0superscript𝑒𝑖superscript𝐇𝑡\rho(t)={\mathbf{\Pi}}\rho(t){\mathbf{\Pi}}={\mathbf{\Pi}}{\bf e}^{i{\bf H}t}{\mathbf{\Pi}}\rho(0){\mathbf{\Pi}}e^{-i{\bf H}t}{\mathbf{\Pi}}=e^{i{\bf H}^{\prime}t}\rho(0)e^{-i{\bf H}^{\prime}t}.

The frozen-out part of the Hilbert space is therefore completely unobservable, and we can act as though the subspace is the only Hilbert space that exists, and as if 𝐇superscript𝐇{\bf H}^{\prime} is the true Hamiltonian. By working only with ρsuperscript𝜌\rho^{\prime} and 𝐇superscript𝐇{\bf H}^{\prime} restricted to the subspace, we have also simplified things by reducing the dimensionality of these matrices.

Sometimes, 𝐇superscript𝐇{\bf H}^{\prime} can possess more symmetry than 𝐇𝐇{\bf H}. Sometimes, 𝐇superscript𝐇{\bf H}^{\prime} can be separable even if 𝐇𝐇{\bf H} is not:

𝐇𝐇=𝐇1𝐈+𝐈𝐇2difference-between𝐇superscript𝐇tensor-productsubscript𝐇1𝐈tensor-product𝐈subscript𝐇2{\bf H}\bumpeq{\bf H}^{\prime}={\bf H}_{1}\otimes{\bf I}+{\bf I}\otimes{\bf H}_{2} (124)

To create such a situation for an arbitrary n×n𝑛𝑛n\times n Hamiltonian, where n=n1n2𝑛subscript𝑛1subscript𝑛2n=n_{1}n_{2}, simply pick a state ρ𝜌\rho such that the spectral densities pksubscript𝑝𝑘p_{k} vanish for all except n1+n21subscript𝑛1subscript𝑛21n_{1}+n_{2}-1 energy eigenvectors. This means that in the energy eigenbasis, with the eigenvectors sorted to place these n1+n21subscript𝑛1subscript𝑛21n_{1}+n_{2}-1 special ones first, ρ𝜌\rho is a block-diagonal matrix vanishing outside of the upper left (n1+n21)×(n1+n21)subscript𝑛1subscript𝑛21subscript𝑛1subscript𝑛21(n_{1}+n_{2}-1)\times(n_{1}+n_{2}-1) block. Equation (74) shows that ρ(t)𝜌𝑡\rho(t) will retain this block form for all time, and that changing the energy eigenvalues Eksubscript𝐸𝑘E_{k} with k>n1+n21𝑘subscript𝑛1subscript𝑛21k>n_{1}+n_{2}-1 leaves the time-evolution of ρ𝜌\rho unaffected. We can therefore choose these eigenvalues so that 𝐇𝐇{\bf H} becomes separable. For example, for the case where the Hilbert space dimensionality n=9𝑛9n=9, suppose that pksubscript𝑝𝑘p_{k} vanishes for all energies except E0subscript𝐸0E_{0}, E1subscript𝐸1E_{1}, E2subscript𝐸2E_{2}, E3subscript𝐸3E_{3}, E4subscript𝐸4E_{4}, and adjust the irrelevant zero-point energy so that E0=0subscript𝐸00E_{0}=0. Then define 𝐇superscript𝐇{\bf H}^{\prime} whose 9 eigenvalues are

(0E1E2E3E1+E3E2+E3E4E1+E4E2+E4).fragments0fragmentsE1fragmentsE2fragmentsE3fragmentsE1E3fragmentsE2E3fragmentsE4fragmentsE1E4fragmentsE2E4\left(\begin{tabular}[]{c@{\hskip 1cm}c@{\hskip 1cm}c}$0$\hfil\hskip 28.45274pt&$E_{1}$\hfil\hskip 28.45274pt&$E_{2}$\\ $E_{3}$\hfil\hskip 28.45274pt&$E_{1}+E_{3}$\hfil\hskip 28.45274pt&$E_{2}+E_{3}$\\ $E_{4}$\hfil\hskip 28.45274pt&$E_{1}+E_{4}$\hfil\hskip 28.45274pt&$E_{2}+E_{4}$\end{tabular}\right). (125)

Note that 𝐇𝐇difference-betweensuperscript𝐇𝐇{\bf H}^{\prime}\bumpeq{\bf H}, and that although 𝐇𝐇{\bf H} is generically not separable, 𝐇superscript𝐇{\bf H}^{\prime} is separable, with subsystem Hamiltonians 𝐇1=diag{0,E1,E2}subscriptsuperscript𝐇1diag0subscript𝐸1subscript𝐸2{\bf H}^{\prime}_{1}=\hbox{diag}\,\{0,E_{1},E_{2}\} and 𝐇2=diag{0,E3,E4}subscriptsuperscript𝐇2diag0subscript𝐸3subscript𝐸4{\bf H}^{\prime}_{2}=\hbox{diag}\,\{0,E_{3},E_{4}\}. Subsystems 1 and 2 will therefore evolve as a parallel universes governed by 𝐇1subscriptsuperscript𝐇1{\bf H}^{\prime}_{1} and 𝐇1subscriptsuperscript𝐇1{\bf H}^{\prime}_{1}, respectively.

IV.7 Minimizing quantum randomness

When we attempted to maximize the independence for a subsystem above, we implicitly wanted to maximize the ability to predict the subsystems future state from its present state. The source of unpredictability that we considered was influence from outside the subsystem, from the environment, which caused decoherence and increased subsystem entropy.

Since we are interested in modeling also conscious systems, there is a second independent source of unpredictability that we need to consider, which can occur even if there is no interaction with the environment: “quantum randomness”. If the system begins in a single conscious state and unitarily evolves into a superposition of subjectively distinguishable conscious states, then the observer in the initial state has no way of uniquely predicting her future perceptions.

A comprehensive framework for treating such situations is given in secondlaw , and in the interest of brevity, we will not review it here, merely use the results. To be able to state them as succinctly as possible, let us first introduce notation for a projection process “pr ” that is in a sense dual to partial-tracing.

For a Hilbert space that is factored into two parts, we define the following notation. We indicate the tensor product structure by splitting a single index α𝛼\alpha into an index pair ii𝑖superscript𝑖ii^{\prime}. For example, if the Hilbert space is the tensor product of an m𝑚m-dimensional and an n𝑛n-dimensional space, then α=n(i1)+i𝛼𝑛𝑖1superscript𝑖\alpha=n(i-1)+i^{\prime}, i=1,,m𝑖1𝑚i=1,...,m, i=1,,nsuperscript𝑖1𝑛i^{\prime}=1,...,n, α=1,,mn𝛼1𝑚𝑛\alpha=1,...,mn, and if 𝐀=𝐁𝐂𝐀tensor-product𝐁𝐂{\bf A}={\bf B}\otimes{\bf C}, then

𝐀αβ=𝐀iijj=𝐁ij𝐂ij.subscript𝐀𝛼𝛽subscript𝐀𝑖superscript𝑖𝑗superscript𝑗subscript𝐁𝑖𝑗subscript𝐂superscript𝑖superscript𝑗{\bf A}_{\alpha\beta}={\bf A}_{ii^{\prime}jj^{\prime}}={\bf B}_{ij}{\bf C}_{i^{\prime}j^{\prime}}. (126)

We define \star as the operation exchanging subsystems 1 and 2:

(𝐀)iijj=𝐀iijjsubscriptsuperscript𝐀𝑖superscript𝑖𝑗superscript𝑗subscript𝐀superscript𝑖𝑖superscript𝑗𝑗({\bf A}^{\star})_{ii^{\prime}jj^{\prime}}={\bf A}_{i^{\prime}ij^{\prime}j} (127)

We define prk𝐀subscriptpr𝑘𝐀\hbox{pr}\,_{k}{\bf A} as the kthsuperscript𝑘𝑡k^{th} diagonal block of 𝐀𝐀{\bf A}:

(prk𝐀)ij=𝐀kikjsubscriptsubscriptpr𝑘𝐀𝑖𝑗subscript𝐀𝑘𝑖𝑘𝑗(\operatornamewithlimits{\hbox{pr}\,}_{k}{\bf A})_{ij}={\bf A}_{kikj}

For example, pr1𝐀subscriptpr1𝐀\hbox{pr}\,_{1}{\bf A} is the m×m𝑚𝑚m\times m upper left corner of 𝐀𝐀{\bf A}.

As before tri𝐀subscripttr𝑖𝐀\hbox{tr}\,_{i}{\bf A}, denotes the partial trace over the ithsuperscript𝑖𝑡i^{th} subsystem:

(tr1𝐀)ijsubscriptsubscripttr1𝐀𝑖𝑗\displaystyle(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A})_{ij} =\displaystyle= k𝐀kikjsubscript𝑘subscript𝐀𝑘𝑖𝑘𝑗\displaystyle\sum_{k}{\bf A}_{kikj} (128)
(tr2𝐀)ijsubscriptsubscripttr2𝐀𝑖𝑗\displaystyle(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A})_{ij} =\displaystyle= k𝐀ikjksubscript𝑘subscript𝐀𝑖𝑘𝑗𝑘\displaystyle\sum_{k}{\bf A}_{ikjk} (129)

The following identities are straightforward to verify:

tr1𝐀subscripttr1superscript𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A}^{\star} =\displaystyle= tr2𝐀subscripttr2𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A} (130)
tr2𝐀subscripttr2superscript𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A}^{\star} =\displaystyle= tr1𝐀subscripttr1𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A} (131)
tr1𝐀subscripttr1𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A} =\displaystyle= kprk𝐀subscript𝑘subscriptpr𝑘𝐀\displaystyle\sum_{k}\operatornamewithlimits{\hbox{pr}\,}_{k}{\bf A} (132)
tr2𝐀subscripttr2𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A} =\displaystyle= kprk𝐀subscript𝑘subscriptpr𝑘superscript𝐀\displaystyle\sum_{k}\operatornamewithlimits{\hbox{pr}\,}_{k}{\bf A}^{\star} (133)
trprk𝐀trsubscriptpr𝑘𝐀\displaystyle\hbox{tr}\,\operatornamewithlimits{\hbox{pr}\,}_{k}{\bf A} =\displaystyle= (tr2𝐀)kksubscriptsubscripttr2𝐀𝑘𝑘\displaystyle(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A})_{kk} (134)
trprk𝐀trsubscriptpr𝑘superscript𝐀\displaystyle\hbox{tr}\,\operatornamewithlimits{\hbox{pr}\,}_{k}{\bf A}^{\star} =\displaystyle= (tr1𝐀)kksubscriptsubscripttr1𝐀𝑘𝑘\displaystyle(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A})_{kk} (135)

Let us adopt the framework of secondlaw and decompose the full Hilbert space into three parts corresponding to the subject (the conscious degrees of freedom of the observer), the object (the external degrees of freedom that the observer is interested in making predictions about) and the environment (all remaining degrees of freedom).

If the subject knows the object-environment density matrix to be ρ𝜌\rho, it obtains its density matrix for the object by tracing out the environment:

ρo=treρ.subscript𝜌𝑜subscripttr𝑒𝜌\rho_{o}=\operatornamewithlimits{\hbox{tr}\,}_{e}\rho.

If the subject-object density matrix is ρ𝜌\rho, then the subject may be in a superposition of having many different perceptions |skketsubscript𝑠𝑘|s_{k}\rangle. Take the |skketsubscript𝑠𝑘|s_{k}\rangle to form a basis of the subject Hilbert space. The probability that the subject finds itself in the state |skketsubscript𝑠𝑘|s_{k}\rangle is

pk=(tr2ρ)kk,subscript𝑝𝑘subscriptsubscripttr2𝜌𝑘𝑘p_{k}=(\operatornamewithlimits{\hbox{tr}\,}_{2}\rho)_{kk}, (136)

and for a subject finding itself in this state |skketsubscript𝑠𝑘|s_{k}\rangle, the object density matrix is

ρo(k)=prkρpk.superscriptsubscript𝜌𝑜𝑘subscriptpr𝑘𝜌subscript𝑝𝑘\rho_{o}^{(k)}={\operatornamewithlimits{\hbox{pr}\,}_{k}\rho\over p_{k}}. (137)

If ρ𝜌\rho refers to a future subject-object state, and the subject wishes to predict its future knowledge of the object, it takes the weighted average of these density matrices, obtaining

ρo=kpkρo(k)=kprkρ=trsρ,subscript𝜌𝑜subscript𝑘subscript𝑝𝑘superscriptsubscript𝜌𝑜𝑘subscript𝑘subscriptpr𝑘𝜌subscripttr𝑠𝜌\rho_{o}=\sum_{k}p_{k}\rho_{o}^{(k)}=\sum_{k}\operatornamewithlimits{\hbox{pr}\,}_{k}\rho=\operatornamewithlimits{\hbox{tr}\,}_{s}\rho,

i.e., it traces out itself! (We used the identity (132) in the last step.) Note that this simple result is independent of whatever basis is used for the object-space, so all issues related to how various states are perceived become irrelevant.

As proven in tripartite , any unitary transformation of a separable ρ𝜌\rho will increase the entropy of tr1ρsubscripttr1𝜌\hbox{tr}\,_{1}\rho. This means that the subject’s future knowledge of ρosubscript𝜌𝑜\rho_{o} is more uncertain than its present knowledge thereof. However, as proven in secondlaw , the future subject’s knowledge of ρosubscript𝜌𝑜\rho_{o} will on average be less uncertain than it presently is, at least if the time-evolution is restricted to be of the measurement type.

The result ρo=tr1ρsubscript𝜌𝑜subscripttr1𝜌\rho_{o}=\operatornamewithlimits{\hbox{tr}\,}_{1}\rho also holds if you measure the object and then forget what the outcome was. In this case, you are simply playing the role of an environment, resulting in the exact same partial-trace equation.

In summary, for a conscious system to be able to predict the future state of what it cares about (ρosubscript𝜌𝑜\rho_{o}) as well as possible, we must minimize uncertainty introduced both by the interactions with the environment (fluctuation, dissipation and decoherence) and by measurement (“quantum randomness”). The future evolution can be better predicted for certain object states than for others, because they are more stable against both of the above-mentioned sources of unpredictability. The utility principle from Table 2 suggests that it is precisely these most stable and predictable states that conscious observers will perceive. The successful “predictability sieve” idea of Zurek and collaborators Zurek05 involves precisely this idea when the source of unpredictability is environment-induced decoherence, so the utility principle lets us generalize this idea to include the second unpredictability source as well: to minimize apparent quantum randomness, we should pay attention to states whose dynamics lets them remain relatively diagonal in the eigenbasis of the subject-object interaction Hamiltonian, so that our future observations of the object are essentially quantum non-demolition measurements.

A classical computer is a flagship example of a such a maximally causal system, minimizing its uncertainty about its future. By clever design, a small subset of the degrees of freedom in the computer, interpreted as bits, deterministically determine their future state with virtually no uncertainty. For my laptop, each bit corresponds to the positions of certain electrons in its memory (determining whether a micro-capacitor is charged). An ideal computer with zero error rate thus has not only complex dynamics (which is Turing-complete modulo resource limitations), but also perfect autonomy, with its future state determined entirely by its own state, independently of the environment state. The Hilbert space factorization that groups the bits of this computer into a subsystem is therefore optimal, in the sense that any other factorization would reduce the autonomy. Moreover, this optimal solution to the quantum factorization problem is quite sharply defined: considering infinitesimal unitary transformations away from this optimum, any transformation that begins rotating an environment bit into the system will cause a sharp reduction of the autonomy, because the decoherence rate for environment qubits (say a thermal collision frequency 1015similar-toabsentsuperscript1015\sim 10^{15} Hz) is orders of magnitude larger than the dynamics rate (say the clock frequency 109similar-toabsentsuperscript109\sim 10^{9} Hz). Note that 𝐇3subscript𝐇3{\bf H}_{3} is far from zero in this example; the pointer basis corresponds to classical bit strings of which the environment performs frequent quantum non-demolition measurements.

This means that if artificial intelligence researchers one day succeed in making a classical computer conscious, and if we turn off any input devices though which our outside world can affect its information processing, then it will subjectively perceive itself as existing in a parallel universe completely disconnected from ours, even though we can probe its internal state from outside. If a future quantum computer is conscious, then it will feel like in a parallel universe evolving under the Hamiltonian 𝐇1(t)subscript𝐇1𝑡{\bf H}_{1}(t) that we have designed for it — until the readout stage, when we switch on an interaction 𝐇3subscript𝐇3{\bf H}_{3}.

IV.8 Optimizing autonomy when the state is given

Let us now consider the case where both 𝐇𝐇{\bf H} and ρ𝜌\rho are treated as given, and we want to vary the Hilbert space factorization to attain maximal separability. 𝐇𝐇{\bf H} and ρ𝜌\rho together determine the full time-evolution ρ(t)𝜌𝑡\rho(t) via the Schrödinger equation, so we seek the unitary transformation 𝐔𝐔{\bf U} that makes 𝐔ρ(t)𝐔𝐔𝜌𝑡superscript𝐔{\bf U}\rho(t){\bf U}^{\dagger} as factorizable as possible. For a pure initial state, exact factorability is equivalent to ρ1(t)subscript𝜌1𝑡\rho_{1}(t) being pure, with ρ1=1normsubscript𝜌11||\rho_{1}||=1 and vanishing linear entropy Slin=1ρ1(t)2superscript𝑆lin1superscriptnormsubscript𝜌1𝑡2S^{\rm lin}=1-||\rho_{1}(t)||^{2}, so let us minimize the linear entropy averaged over a range of times. As a concrete example, we minimize the function

f(𝐔)11mi=1mtr1𝐔ρ(ti)𝐔2,𝑓𝐔11𝑚superscriptsubscript𝑖1𝑚superscriptnormsubscripttr1𝐔𝜌subscript𝑡𝑖superscript𝐔2f({\bf U})\equiv 1-{1\over m}\sum_{i=1}^{m}||\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf U}\rho(t_{i}){\bf U}^{\dagger}||^{2}, (138)

using 9 equispaced times tisubscript𝑡𝑖t_{i} ranging from t=0𝑡0t=0 and t=1𝑡1t=1, a random 4×4444\times 4 Hamiltonian 𝐇𝐇{\bf H}, and a random pure state ρ(0)𝜌0\rho(0).

Refer to caption

Figure 15: The Hilbert-Schmidt norm ρ1normsubscript𝜌1||\rho_{1}|| is plotted for a random pure-state 2-qubit system when factorizing the Hilbert space in the original basis (black curve) and after a unitary transformation optimized to keep ρ1subscript𝜌1\rho_{1} as pure as possible for t1𝑡1t\leq 1 (red/grey curve).

The result of numerically solving this optimization problem is shown in Figure 15, and we see that the new factorization keeps the norm ρ1normsubscript𝜌1||\rho_{1}|| visually indistinguishable from unity for the entire time period optimized for. The optimization reduced the average Shannon entropy over this period from S1.1𝑆1.1S\approx 1.1 bits to S=0.0009𝑆0.0009S=0.0009 bits.

The reason that the optimization is so successful is presumably that it by adjusting N=n2n12n22=1644=8𝑁superscript𝑛2superscriptsubscript𝑛12superscriptsubscript𝑛2216448N=n^{2}-n_{1}^{2}-n_{2}^{2}=16-4-4=8 real parameters151515There are n2superscript𝑛2n^{2} parameters for 𝐔𝐔{\bf U}, but transformations within each of the two subspaces have no effect, wasting n12superscriptsubscript𝑛12n_{1}^{2} and n22superscriptsubscript𝑛22n_{2}^{2} parameters. in 𝐔𝐔{\bf U}, it is able to approximately zero out the first N𝑁N terms in the Taylor expansion of Slin(t)superscript𝑆lin𝑡S^{\rm lin}(t), whose leading terms are given by equations (99)- (101). A series of similar numerical experiments indicated that such excellent separability could generally be found as long as the number of time steps tisubscript𝑡𝑖t_{i} was somewhat smaller than the number of free parameters N𝑁N but not otherwise, suggesting that separability can be extended over long time periods for large n𝑛n. However, because we are studying only unitary evolution here, neglecting the important projection effect from the previous section, it is unclear how relevant these results are to our underlying goal. We have therefore not extended these numerical optimizations, which are quite time-consuming, to larger n𝑛n.

V Conclusions

In this paper, we have explored two problems that are intimately related. The first problem is that of understanding consciousness as a state of matter, “perceptronium”. We have focused not on solving this problem, but rather on exploring the implications of this viewpoint. Specifically, we have explored four basic principles that may distinguish conscious matter from other physical systems: the information, integration, independence and dynamics principles.

The second one is the physics-from-scratch problem: If the total Hamiltonian 𝐇𝐇{\bf H} and the total density matrix ρ𝜌\rho fully specify our physical world, how do we extract 3D space and the rest of our semiclassical world from nothing more than two Hermitian matrices? Can some of this information be extracted even from 𝐇𝐇{\bf H} alone, which is fully specified by nothing more than its eigenvalue spectrum? We have focused on a core part of this challenge which we have termed the quantum factorization problem: why do conscious observers like us perceive the particular Hilbert space factorization corresponding to classical space (rather than Fourier space, say), and more generally, why do we perceive the world around us as a dynamic hierarchy of objects that are strongly integrated and relatively independent?

These two problems go hand in hand, because a generic Hamiltonian cannot be decomposed using tensor products, which would correspond to a decomposition of the cosmos into non-interacting parts, so there is some optimal factorization of our universe into integrated and relatively independent parts. Based on Tononi’s work, we might expect that this factorization, or some generalization thereof, is what conscious observers perceive, because an integrated and relatively autonomous information complex is fundamentally what a conscious observer is.

V.1 Summary of findings

We first explored the integration principle, and found that classical physics allows information to be essentially fully integrated using error-correcting codes, so that any subset containing up to about half the bits can be reconstructed from the remaining bits. Information stored in Hopfield neural networks is naturally error-corrected, but 1011superscript101110^{11} neurons support only about 37 bits of integrated information. This leaves us with an integration paradox: why does the information content of our conscious experience appear to be vastly larger than 37 bits? We found that generalizing these results to quantum information exacerbated this integration paradox, allowing no more than about a quarter of a bit of integrated information — and this result applied not only to Hopfield networks of a given size, but to the state of any quantum system of any size. This strongly implies that the integration principle must be supplemented by at least one additional principle.

We next explored the independence principle and the extent to which a Hilbert space factorization can decompose the Hamiltonian 𝐇𝐇{\bf H} (as opposed to the state ρ𝜌\rho) into independent parts. We quantified this using projection operators in the Hilbert-Schmidt vector space where 𝐇𝐇{\bf H} and ρ𝜌\rho are viewed as vectors rather than operators, and proved that the best decomposition can always be found in the energy eigenbasis, where 𝐇𝐇{\bf H} is diagonal. This leads to a more pernicious variant of the Quantum Zeno Effect that we termed the Quantum Zeno Paradox: if we decompose our universe into maximally independent objects, then all change grinds to a halt. Since conscious observers clearly do not perceive reality as being static and unchanging, the integration and independence principles must therefore be supplemented by at least one additional principle.

We then explored the dynamics principle, according to which a conscious system has the capacity to not only store information, but also to process it. We found the energy coherence δH2trρ˙2𝛿𝐻2trsuperscript˙𝜌2\delta H\equiv\sqrt{2\>\hbox{tr}\,\dot{\rho}^{2}} to be a convenient measure of dynamics: it can be proven to be time-independent, and it reduces to the energy uncertainty ΔHΔ𝐻\Delta H for the special case of pure states. Maximizing dynamics alone gives boring periodic solutions unable to support complex information processing, but reducing δH𝛿𝐻\delta H by merely a modest percentage enables chaotic and complex dynamics that explores the full dimensionality of the Hilbert space. We found that high autonomy (a combination of dynamics and independence) can be attained even if the environment interaction is strong. One class of examples involves the environment effectively performing quantum-non-demolition measurements of the autonomous system, whose internal dynamics causes the non-negligible elements of the density matrix ρ𝜌\rho to “slide along the diagonal” in the measured basis, remaining in the low-decoherence subspace. We studied such an example involving a truncated harmonic oscillator coupled to an external spin, and saw that it is easy to find classes of systems whose autonomy grows exponentially with the system size (measured in qubits). Generalized coherent states with Gaussian wavefunctions appeared particularly robust toward interactions with steep/short-range potentials. We found that any given 𝐇𝐇{\bf H} can also be perfectly decomposed given a suitably chosen ρ𝜌\rho that assigns zero amplitude to some energy eigenstates. When optimizing the Hilbert space factorization for 𝐇𝐇{\bf H} and ρ𝜌\rho jointly, it appears possible to make a subsystem history ρ1(t)subscript𝜌1𝑡\rho_{1}(t) close to separable for a long time. However, it is unclear how relevant this is, because the state projection caused by observation also alters ρ1subscript𝜌1\rho_{1}.

V.2 How does a conscious entity perceive the world?

What are we to make of these findings? We have not solved the quantum factorization problem, but our results have brought it into sharper focus, and highlighted both concrete open sub-problems and various hints and clues from observation about paths forward. Let us first discuss some open problems, then turn to the hints.

For the physics-from-scratch problem of deriving how we perceive our world from merely 𝐇𝐇{\bf H}, ρ𝜌\rho and the Schrödinger equation, there are two possibilities: either the problem is well-posed or it is not. If not, this would be very interesting, implying that some sort of additional structure beyond ρ𝜌\rho and 𝐇𝐇{\bf H} is needed at the fundamental level — some additional mathematical structure encoding properties of space, for instance, which would be surprising given that this appears unnecessary in lattice Gauge theory (see Appendix C). Since we have limited our treatment to unitary non-relativistic quantum mechanics, obvious candidates for missing structure relate to relativity and quantum gravity, where the Hamiltonian vanishes, and to mechanisms causing non-unitary wavefunction collapse. Indeed, Penrose and others have speculated that gravity is crucial for a proper understanding of quantum mechanics even on small scales relevant to brains and laboratory experiments, and that it causes non-unitary wavefunction collapse PenroseBook . Yet the Occam’s razor approach is clearly the commonly held view that neither relativistic, gravitational nor non-unitary effects are central to understanding consciousness or how conscious observers perceive their immediate surroundings: astronauts appear to still perceive themselves in a semiclassical 3D space even when they are effectively in a zero-gravity environment, seemingly independently of relativistic effects, Planck-scale spacetime fluctuations, black hole evaporation, cosmic expansion of astronomically distant regions, etc.

If, on the other hand, the physics-from-scratch problem is well-posed, we face crucial unanswered questions related to Hilbert space factorization. Why do we perceive electromagnetic waves as transferring information between different regions of space, rather than as completely independent harmonic oscillators that each stay put in a fixed spatial location? These two viewpoints correspond to factoring the Hilbert space of the electromagnetic field in either real space or Fourier space, which are simply two unitarily equivalent Hilbert space bases. Moreover, how can we perceive a harmonic oscillator as an integrated system when its Hamiltonian can, as reviewed in Appendix B, be separated into completely independent qubits? Why do we perceive a magnetic system described by the 3D Ising model as integrated, when it separates into completely independent qubits after a unitary transformation?161616If we write the Ising Hamiltonian as a quadratic function of σxsubscript𝜎𝑥\sigma_{x}-operators, then it is also quadratic in the annihilation and creation operators and can therefore be diagonalized after a Jordan-Wigner transform Nielsen05 . Note that such diagonalization is impossible for the Heisenberg ferromagnet, whose couplings are quadratic in all three Pauli matrices, because σz2superscriptsubscript𝜎𝑧2\sigma_{z}^{2}-terms are quartic in the annihilation and creation operators. In all three cases, the answer clearly lies not within the system itself (in its internal dynamics 𝐇1subscript𝐇1{\bf H}_{1}), but in its interaction 𝐇3subscript𝐇3{\bf H}_{3} with the rest of the world. But 𝐇3subscript𝐇3{\bf H}_{3} involves the factorization problem all over again: whence this distinction between the system itself and the rest of the world, when there are countless other Hilbert space factorizations that mix the two?

V.3 Open problems

Based on our findings, three specific problems stand in the way of solving the quantum factorization problem and answering these questions, and we will now discuss each of them in turn.

V.3.1 Factorization and the chicken-and-egg problem

What should we determine first: the state or the factorization? If we are given a Hilbert space factorization and an environment state, we can use the predictability sieve formalism Zurek05 to find the states of our subsystem that are most robust toward decoherence. In some simple cases, they are eigenstates of the effective interaction Hamiltonian 𝐇subscript𝐇{\bf H}_{*} from equation (88). However, to find the best factorization, we need information about the state. A clock is a highly autonomous system if we factor the Hilbert space so that the first factor corresponds to the spatial volume containing the clock, but if the state were different such that the clock were somewhere else, we should factor out a different volume. Moreover, if the state has the clock in a superposition of two macroscopically different locations, then there is no single optimal factorization, but instead a separate one for each branch of the wavefunction. An observer looking at the clock would use the clock position seen to project onto the appropriate branch using equation (137), so the solution to the quantum factorization problem that we should be looking for is not a single unique factorization of the Hilbert space. Rather, we need a criterion for identifying conscious observers, and then a prescription that determines which factorization each of them will perceive.

V.3.2 Factorization and the integration paradox

A second challenge that we have encountered is the extreme separability possible for both 𝐇𝐇{\bf H} and ρ𝜌\rho. In the introduction, we expressed hope that the apparent integration of minds and external objects might trace back to the fact that for generic ρ𝜌\rho and 𝐇𝐇{\bf H}, there is no Hilbert space factorization that makes ρ𝜌\rho factorizable or 𝐇𝐇{\bf H} additively separable. Yet by generalizing Tononi’s ideas to quantum systems, we found that what he terms the “cruelest cut” is very cruel indeed, able to reduce the mutual information in ρ𝜌\rho to no more than about 0.250.250.25 bits, and typically able to make the interaction Hamiltonian 𝐇3subscript𝐇3{\bf H}_{3} very small as well. We saw in Section IV.8 that even the combined effects ρ𝜌\rho and 𝐇𝐇{\bf H} can typically be made close to separable, in the sense that there is a Hilbert space factorization where a subsystem history ρ1(t)subscript𝜌1𝑡\rho_{1}(t) is close to separable for a long time. So why do we nonetheless perceive out universe as being relatively integrated, with abundant information available to us from near and far? Why do we not instead perceive our mind as essentially constituting its own parallel universe, solipsism-style, with merely exponentially small interactions with the outside world? We saw that the origin of this integration paradox is the vastness of the group of unitary transformations that we are minimizing over, whose number of parameters scales like n2=22bsuperscript𝑛2superscript22𝑏n^{2}=2^{2b} with the number of qubits b𝑏b and thus grows exponentially with system size (measured in either volume or number of particles).

V.3.3 Factorization and the emergence of time

A third challenge involves the emergence of time. Although this is a famously thorny problem in quantum gravity, our results show that it appears even in non-relativistic unitary quantum mechanics. It is intimately linked with our factorization problem, because we are optimizing over all unitary transformations 𝐔𝐔{\bf U}, and time evolution is simply a one-dimensional subset of these transformations, given by 𝐔=ei𝐇t𝐔superscript𝑒𝑖𝐇𝑡{\bf U}=e^{i{\bf H}t}. Should the optimal factorization be determined separately at each time, or only once and for all? In the latter case, this would appear to select only one special time when our universe is optimally separable, seemingly contrary to our observations that the laws of physics are time-translation invariant. In the former case, the continuous change in factorization will simply undo time evolution Schwindt12 , making you feel that time stands still! Observationally, it is obvious that the optimal factorization can change at least somewhat with time, since our designation of objects is temporary: the atoms of a highly autonomous wooden bowling ball rolling down a lane were once dispersed (as CO2 and H2O in the air, etc.) and will eventually disperse again.

An obvious way out of this impasse is to bring consciousness back to center-stage as in Section IV.7 and brain ; tripartite ; secondlaw . Whenever a conscious observer interacts with her environment and gains new information, the state ρ𝜌\rho with which she describes her world gets updated according to equation (137), the quantum-mechanical version of Bayes Theorem tripartite . This change in her ρ𝜌\rho is non-unitary and therefore evades our timelessness argument above. Because she always perceives herself in a pure state, knowing the state of her mind, the joint state or her and the rest of the world is always separable. It therefore appears that if we can one day solve the quantum factorization problem, then we will find that the emergence of time is linked to the emergence of consciousness: the former cannot be fully understood without the latter.

V.4 Observational hints and clues

In summary, the quantum factorization problem is both very interesting and very hard. However, as opposed to the hard problem of quantum gravity, say, where we have few if any observational clues to guide us, physics research has produced many valuable hints and clues relevant to the quantum factorization problem. The factorization of the world that we perceive and the quantum states that we find objects in have turned out to be exceptionally unusual and special in various ways, and for each such way that we can identify, quantify and understand the underlying principle responsible for, we will make another important stride towards solving the factorization problem. Let us now discuss the hints that we have identified upon so far.

V.4.1 The universality of the utility principle

The principles that we listed in Table 2 were for conscious systems. If we shift attention to non-conscious objects, we find that although dynamics, independence and integration still apply in many if not most cases, the utility principle is the only one that universally applies to all of them. For example, a rain drop lacks significant information storage capacity, a boulder lacks dynamics, a cogwheel can lack independence, and a sand pile lacks integration. This universality of the utility principle is hardly surprising, since utility is presumably the reason we evolved consciousness in the first place. This suggests that we examine all other clues below through the lens of utility, to see whether the unusual circumstances in question can be explained via some implication of the utility principle. In other words, if we find that useful consciousness can only exist given certain strict requirements on the quantum factorization, then this could explain why we perceive a factorization satisfying these requirements.

V.4.2 ρ𝜌\rho is exceptional

The observed state ρ𝜌\rho of our universe is exceptional in that it is extremely cold, with most of the Hilbert space frozen out — what principles might require this? Perhaps this is useful for consciousness by allowing relatively stable information storage and by allowing large autonomous systems thanks to the large available dynamic range in length scales (universe/brain/atom/Planck scale)? Us being far from thermal equilibrium with our 300K planet dumping heat from our 6000K sun into our 3K space is clearly conducive to dynamics and information processing.

V.4.3 𝐇𝐇{\bf H} is exceptional

The Hamiltonian 𝐇𝐇{\bf H} of the standard model of particle physics is of the very special form

𝐇=𝐇𝐫(𝐫)d3r,𝐇subscript𝐇𝐫𝐫superscript𝑑3𝑟{\bf H}=\int{\bf H}_{\bf r}({\bf r})d^{3}r, (139)

which is seen to be almost additively separable in the spatial basis, and in no other basis. Although equation (139) superficially looks completely separable just as 𝐇=i𝐇i𝐇subscript𝑖subscript𝐇𝑖{\bf H}=\sum_{i}{\bf H}_{i}, there is a coupling between infinitesimally close spatial points due to spatial derivatives in the kinetic terms. If we replace the integral by a sum in equation (139) by discretizing space as in lattice gauge theory, we need couplings only between nearest-neighbor points. This is a strong hint of the independence principle at work; all this near-independence gets ruined by a generic unitary transformation, making the factorization corresponding to our 3D physical space highly special; indeed, 3D space and the exact form of equation (139) could presumably be inferred from simply knowing the spectrum of 𝐇𝐇{\bf H}.

𝐇𝐇{\bf H} from equation (139) is also exceptional in that it contains mainly quadratic, cubic and quartic functions of the fermion and boson fields, which can in turn be expressed linearly or quadratically in terms of qubit raising and lowering operators (see Appendix C). A generic unitary transformation would ruin this simplicity as well, introducing polynomials of enormous degree. What principle might be responsible for this?

𝐇𝐇{\bf H} from equation (139) is also exceptional by exhibiting tremendous symmetry: the form of 𝐇𝐫subscript𝐇𝐫{\bf H}_{\bf r} in invariant under both space and time translation, and indeed under the full Poincare group; using a factorization other than 3D space would ruin this symmetry.

V.4.4 The ubiquity of autonomy

When discussing the integration paradox above, we worried about factorizations splitting the world into nearly independent parts. If there is a factorization with 𝐇3=0subscript𝐇30{\bf H}_{3}=0, then the two subsystems are independent for any state, for all time, and will act as two parallel universes. This means that if the only way to achieve high independence were to make 𝐇3subscript𝐇3{\bf H}_{3} tiny, the integration paradox would indeed be highly problematic. However, we saw in Section IV that this is not at all the case: it is quite easy to achieve high independence for some states, at least temporarily, even when 𝐇3subscript𝐇3{\bf H}_{3} is large. The independence principle therefore does not push us inexorably towards perceiving a more disconnected world than the one we are familiar with. The ease of approximately factoring ρ1(t)subscript𝜌1𝑡\rho_{1}(t) during a significant time period as in Section IV.8 also appears unlikely to be a problem: as mentioned, our calculation answered the wrong question by studying only unitary evolution, neglecting projection. The take-away hint is thus that observation needs to be taken into account to address this issue properly, just as we argued that it must be taken into account to understand the emergence of time.

V.4.5 Decoherence as enemy

Early work on decoherence Zeh70 ; JZ85 portrayed it mainly as an enemy, rapidly killing off most quantum states, with only a tiny minority surviving long enough to be observable. For example, a bowling ball gets struck by about 1025superscript102510^{25} air molecules each second, and a single strike suffices to ruin any macrosuperposition of the balls position extending further than about an angstrom, the molecular De Broglie wavelength JZ85 ; collapse . The successful predictability sieve idea of Zurek and collaborators Zurek05 states that we will only perceive those quantum states that are most robust towards decoherence, which in the case of macroscopic objects such as bowling balls selects roughly classical states with fairly well-defined positions. In situations where the position basis emerges as special, this might thus trace back to the environmental interactions 𝐇3subscript𝐇3{\bf H}_{3} (with air molecules etc.) probing the position, which might in turn traces back to the fact that 𝐇𝐇{\bf H} from equation (139) is roughly separable in the position basis. Note, however, that the general situation is more complicated, since the predictability sieve depends also on the state ρ𝜌\rho, which might contain long-distance entanglement built up over time by the kinetic terms in equation (139). Indeed, ρ𝜌\rho can describe a laboratory where a system is probed in a non-spatial basis, causing the predictablity sieve to favor, say, energy eigenstates.

In terms of Table 2, we can view the predictability sieve as an application of the utility principle, since there is clearly no utility in trying to perceive something that will be irrelevant 1025superscript102510^{-25} seconds later. In summary, the hint from this negative view of decoherence is that we should minimize it, either by factoring to minimize 𝐇3subscript𝐇3{\bf H}_{3} itself or by using robust states on which 𝐇3subscript𝐇3{\bf H}_{3} essentially performs quantum non-demolition measurements.

V.4.6 Decoherence as friend

Although quantum computer builders still view decoherence as their enemy, more recent work on decoherence has emphasized that it also has a positive side: the Quantum Darwinism framework Zurek09 emphasizes the role of environment interactions 𝐇3subscript𝐇3{\bf H}_{3} as a valuable communication channel, repeatedly copying information about the states of certain systems into the environment171717Charles Bennett has suggested that Quantum Darwinism would be more aptly named “Quantum Spam”, since the many redundant imprints of the system’s state are normally not further reproduced., thereby helping explain the emergence of a consensus reality mubook . Quantum Darwinism can also be viewed as an application of the utility principle: it is only useful for us to try to be aware of things that we can get information about, i.e., about states that have quantum-spammed the environment with redundant copies of themselves. A hint from this positive view of environmental interactions is that we should not try to minimize 𝐇3subscript𝐇3{\bf H}_{3} after all, but should instead reduce decoherence by the second mechanism: using states that are approximate eigenstates of the effective interaction 𝐇subscript𝐇{\bf H}_{*} and therefore get abundantly copied into the environment.

Further work on Quantum Darwinism has revealed that such situations are quite exceptional, reaching the following conclusion Riedel12 : “A state selected at random from the Hilbert space of a many-body system is overwhelmingly likely to exhibit highly non-classical correlations. For these typical states, half of the environment must be measured by an observer to determine the state of a given subsystem. The objectivity of classical reality — the fact that multiple observers can agree on the state of a subsystem after measuring just a small fraction of its environment — implies that the correlations found in nature between macroscopic systems and their environments are very exceptional.” This gives a hint that the particular Hilbert space factorization we observe might be very special and unique, so that using the utility principle to insist on the existence of a consensus reality may have large constraining power among the factorizations — perhaps even helping nail down the one we actually observe.

V.5 Outlook

In summary, the hypothesis that consciousness can be understood as a state of matter leads to fascinating interdisciplinary questions spanning the range from neuroscience to computer science, condensed matter physics and quantum mechanics. Can we find concrete examples of error-correcting codes in the brain? Are there brain-sized non-Hopfield neural networks that support much more than 37 bits of integrated information? Can a deeper understanding of consciousness breathe new life into the century-old quest to understand the emergence of a classical world from quantum mechanics, and can it even help explain how two Hermitian matrices 𝐇𝐇{\bf H} and ρ𝜌\rho lead to the subjective emergence of time? The quests to better understand the internal reality of our mind and the external reality of our universe will hopefully assist one another.


Acknowledgments: The author wishes to thank Christoph Koch, Meia Chita-Tegmark, Russell Hanson, Hrant Gharibyan, Seth Lloyd, Bill Poirier, Matthew Pusey, Harold Shapiro and Marin Soljačić and for helpful information and discussions, and Hrant Gharibyan for mathematical insights regarding the ρ𝜌\rho- and 𝐇𝐇{\bf H}-diagonality theorems. This work was supported by NSF AST-090884 & AST-1105835.

References

  • (1) A. Almheiri, D. Marolf, J. Polchinski, and J. Sully, JHEP 2, 62 (2013).
  • (2) T. Banks, W. Fischler, S. Kundu, and J. F. Pedraza, arXiv:1401.3341 (2014).
  • (3) S. Saunders, J. Barrett, A. Kent, and D. Wallace, Many Worlds? Everett, Quantum Theory, & Reality (Oxford, Oxford Univ. Press, 2010).
  • (4) M. Tegmark, PRE 61, 4194 (2000).
  • (5) D. J. Chalmers, J. Consc. Studies 2, 200 (1995).
  • (6) P. Hut, M. Alford, and M. Tegmark, Found. Phys. 36, 765 (2006, physics/0510188).
  • (7) M. Tegmark, Found.Phys. 11/07, 116 (2007).
  • (8) G. Tononi, Biol. Bull. 215, 216, http://www.biolbull.org/content/215/3/216.full (2008).
  • (9) S. Dehaene, Neuron 70, 200 (2011).
  • (10) G. Tononi, Phi: A Voyage from the Brain to the Soul (New York, Pantheon, 2012).
  • (11) A. Casali et al., Sci. Transl. Med 198, 1 (2013).
  • (12) M. Oizumi, L. Albantakis, and Tononi G, PLoS comp. bio, e1003588 (2014).
  • (13) S. Dehaene et al., Current opinion in neurobiology 25, 76 (2014).
  • (14) B. A. Wilson and D. Wearing 1995, in Broken memories: Case studies in memory impairment, ed. R. Campbell and M. A. Conway (Malden: Blackwell)
  • (15) I. Amato, Science 253, 856 (1991).
  • (16) S. Lloyd, Nature 406, 1-47 (2000).
  • (17) G. t’Hooft, arXiv:gr-qc/9310026 (1993).
  • (18) J. Schwindt, arXiv:1210.8447 [quant-ph] (2012).
  • (19) A. Damasio, Self Comes to Mind: Constructing the Conscious Brain (New York, Vintage, 2010).
  • (20) R. W. Hamming, The Bell System Technical Journal 24, 2 (1950).
  • (21) M. Grassl, http://i20smtp.ira.uka.de/home/grassl/codetables/
  • (22) J. J. Hopfield, Proc. Natl. Acad. Sci. 79, 2554 (1982).
  • (23) N. J. Joshi, G. Tononi, and C. Koch, PLOS Comp. Bio. 9, e1003111 (2013).
  • (24) O. Barak et al., Progr. Neurobio. 103, 214 (2013).
  • (25) Yoon K et al., Nature Neuroscience 16, 1077 (2013).
  • (26) D. J. C McKay, Information Theory, Inference, and Learning Algorithms (Cambridge, Cambridge University Press, 2003).
  • (27) K. Küpfmüller, Nachrichtenverarbeitung im Menschen, in Taschenbuch der Nachrichtenverarbeitung, K. Steinbuch, Ed., 1481-1502 (1962).
  • (28) T. Nørretranders, The User Illusion: Cutting Consciousness Down to Size (New York, Viking, 1991).
  • (29) S. Jevtic, Jennings D, and T. Rudolph, PRL 108, 110403 (2012).
  • (30) J. von Neumann., Die mathematischen Grundlagen der Quantenmechanik (Berlin., Springer, 1932).
  • (31) A. W. Marshall, I. Olkin, and B,. Inequalities: Theory of Majorization and Its Applications, 2nd ed. Arnold (New York, Springer, 2011).
  • (32) S. Bravyi, Quantum Inf. and Comp. 4, 12 (2004).
  • (33) W. H. Zurek, quant-ph/0111137 (2001).
  • (34) H. D. Zeh, Found.Phys. 1, 69 (1970).
  • (35) E. Joos and H. D. Zeh, Z. Phys. B 59, 223 (1985).
  • (36) W. H. Zurek, S. Habib, and J. P. Paz, PRL 70, 1187 (1993).
  • (37) D. Giulini, E. Joos, C. Kiefer, J. Kupsch, I. O. Stamatescu, and H. D. Zeh, Decoherence and the Appearance of a Classical World in Quantum Theory (Springer, Berlin, 1996).
  • (38) W. H. Zurek, Nature Physics 5, 181 (2009).
  • (39) M. Schlosshauer, Decoherence and the Quantum-To-Classical Transition (Berlin, Springer, 2007).
  • (40) W. H. Zurek, Nature Physics 5, 181 (2009).
  • (41) E. C. G Sudarshan and B. Misra, J. Math. Phys. 18, 756 (1977).
  • (42) R. Omnès, quant-ph/0106006 (2001).
  • (43) J. Gemmer and G. Mahler, Eur. Phys J. D 17, 385 (2001).
  • (44) T. Durt, Z. Naturforsch. 59a, 425 (2004).
  • (45) W. H. Zurek, S. Habib, and J. P. Paz, PRL 70, 1187 (1993).
  • (46) M. Tegmark and H. S. Shapiro, Phys. Rev. E 50, 2538 (1994).
  • (47) H. Gharibyan and M. Tegmark, arXiv:1309.7349 [quant-ph] (2013).
  • (48) M. Tegmark, PRD 85, 123517 (2012).
  • (49) Nielsen 2005, http://michaelnielsen.org/blog/archive/notes/fermions_and_jordan_wigner.pdf
  • (50) D. A. R Dalvit, J. Dziarmaga, and W. H. Zurek, PRA 72, 062101 (2005).
  • (51) R. Penrose, The Emperor’s New Mind (Oxford, Oxford Univ. Press, 1989).
  • (52) M. Tegmark, Found. Phys. Lett. 6, 571 (1993).
  • (53) M. Tegmark, Our Mathematical Universe: My Quest for the Ultimate Nature of Reality (New York, Knopf, 2014).
  • (54) C. J. Riedel, W. H. Zurek, and M. Zwolak, New J. Phys. 14, 083010 (2012).
  • (55) S. Lloyd, Programming the Universe (New York, Knopf, 2006).
  • (56) Z. Gu and X. Wen, Nucl.Phys. B 863, 90 (2012).
  • (57) X. Wen, PRD 68, 065003 (2003).
  • (58) M. A. Levin and X. Wen, RMP 77, 871 (2005).
  • (59) M. A. Levin and X. Wen, PRB 73, 035122 (2006).
  • (60) M. Tegmark and L. Yeh, Physica A 202, 342 (1994).

Appendix A Useful identities involving tensor products

Below is a list of useful identities involving tensor multiplication and partial tracing, many of which are used in the main part of the paper. Although they are all straightforward to prove by writing them out in the index notation of equation (126), I have been unable to find many of them in the literature. The tensor product tensor-product\otimes is also known as the Kronecker product.

(𝐀𝐁)𝐂tensor-producttensor-product𝐀𝐁𝐂\displaystyle({\bf A}\otimes{\bf B})\otimes{\bf C} =\displaystyle= 𝐀(𝐁𝐂)tensor-product𝐀tensor-product𝐁𝐂\displaystyle{\bf A}\otimes({\bf B}\otimes{\bf C}) (140)
𝐀(𝐁+𝐂)tensor-product𝐀𝐁𝐂\displaystyle{\bf A}\otimes({\bf B}+{\bf C}) =\displaystyle= 𝐀𝐁+𝐀𝐂tensor-product𝐀𝐁tensor-product𝐀𝐂\displaystyle{\bf A}\otimes{\bf B}+{\bf A}\otimes{\bf C} (141)
(𝐁+𝐂)𝐀tensor-product𝐁𝐂𝐀\displaystyle({\bf B}+{\bf C})\otimes{\bf A} =\displaystyle= 𝐁𝐀+𝐂𝐀tensor-product𝐁𝐀tensor-product𝐂𝐀\displaystyle{\bf B}\otimes{\bf A}+{\bf C}\otimes{\bf A} (142)
(𝐀𝐁)superscripttensor-product𝐀𝐁\displaystyle({\bf A}\otimes{\bf B})^{\dagger} =\displaystyle= 𝐀𝐁tensor-productsuperscript𝐀superscript𝐁\displaystyle{\bf A}^{\dagger}\otimes{\bf B}^{\dagger} (143)
(𝐀𝐁)1superscripttensor-product𝐀𝐁1\displaystyle({\bf A}\otimes{\bf B})^{-1} =\displaystyle= 𝐀1𝐁1tensor-productsuperscript𝐀1superscript𝐁1\displaystyle{\bf A}^{-1}\otimes{\bf B}^{-1} (144)
tr[𝐀𝐁]trdelimited-[]tensor-product𝐀𝐁\displaystyle\hbox{tr}\,[{\bf A}\otimes{\bf B}] =\displaystyle= (tr𝐀)(tr𝐁)tr𝐀tr𝐁\displaystyle(\hbox{tr}\,{\bf A})(\hbox{tr}\,{\bf B}) (145)
tr1[𝐀𝐁]subscripttr1tensor-product𝐀𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[{\bf A}\otimes{\bf B}] =\displaystyle= (tr𝐀)𝐁tr𝐀𝐁\displaystyle(\operatornamewithlimits{\hbox{tr}\,}{\bf A}){\bf B} (146)
tr2[𝐀𝐁]subscripttr2tensor-product𝐀𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf A}\otimes{\bf B}] =\displaystyle= (tr𝐁)𝐀tr𝐁𝐀\displaystyle(\operatornamewithlimits{\hbox{tr}\,}{\bf B}){\bf A} (147)
tr1[𝐀(𝐁𝐈)]subscripttr1𝐀tensor-product𝐁𝐈\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[{\bf A}({\bf B}\otimes{\bf I})] =\displaystyle= tr1[(𝐁𝐈)𝐀]subscripttr1tensor-product𝐁𝐈𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[({\bf B}\otimes{\bf I}){\bf A}] (148)
tr2[𝐀(𝐈𝐁)]subscripttr2𝐀tensor-product𝐈𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf A}({\bf I}\otimes{\bf B})] =\displaystyle= tr2[(𝐈𝐁)𝐀]subscripttr2tensor-product𝐈𝐁𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[({\bf I}\otimes{\bf B}){\bf A}] (149)
tr1[(𝐈𝐀)𝐁]subscripttr1tensor-product𝐈𝐀𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[({\bf I}\otimes{\bf A}){\bf B}] =\displaystyle= 𝐀(tr1𝐁)𝐀subscripttr1𝐁\displaystyle{\bf A}(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf B}) (150)
tr2[(𝐀𝐈)𝐁]subscripttr2tensor-product𝐀𝐈𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[({\bf A}\otimes{\bf I}){\bf B}] =\displaystyle= 𝐀(tr2𝐁)𝐀subscripttr2𝐁\displaystyle{\bf A}(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf B}) (151)
tr1[𝐀(𝐈𝐁)]subscripttr1𝐀tensor-product𝐈𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[{\bf A}({\bf I}\otimes{\bf B})] =\displaystyle= (tr1𝐀)𝐁subscripttr1𝐀𝐁\displaystyle(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A}){\bf B} (152)
tr2[𝐀(𝐁𝐈)]subscripttr2𝐀tensor-product𝐁𝐈\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf A}({\bf B}\otimes{\bf I})] =\displaystyle= (tr2𝐀)𝐁subscripttr2𝐀𝐁\displaystyle(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A}){\bf B} (153)
tr1[𝐀(𝐁𝐂)]subscripttr1𝐀tensor-product𝐁𝐂\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[{\bf A}({\bf B}\otimes{\bf C})] =\displaystyle= tr1[𝐀(𝐁𝐈)]𝐂subscripttr1𝐀tensor-product𝐁𝐈𝐂\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[{\bf A}({\bf B}\otimes{\bf I})]{\bf C} (154)
tr2[𝐀(𝐁𝐂)]subscripttr2𝐀tensor-product𝐁𝐂\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf A}({\bf B}\otimes{\bf C})] =\displaystyle= tr2[𝐀(𝐈𝐂)]𝐁subscripttr2𝐀tensor-product𝐈𝐂𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[{\bf A}({\bf I}\otimes{\bf C})]{\bf B} (155)
tr1[(𝐁𝐂)𝐀]subscripttr1tensor-product𝐁𝐂𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{1}[({\bf B}\otimes{\bf C}){\bf A}] =\displaystyle= 𝐂tr1[(𝐀𝐈)𝐁]𝐂subscripttr1tensor-product𝐀𝐈𝐁\displaystyle{\bf C}\>\operatornamewithlimits{\hbox{tr}\,}_{1}[({\bf A}\otimes{\bf I}){\bf B}] (156)
tr2[(𝐁𝐂)𝐀]subscripttr2tensor-product𝐁𝐂𝐀\displaystyle\operatornamewithlimits{\hbox{tr}\,}_{2}[({\bf B}\otimes{\bf C}){\bf A}] =\displaystyle= 𝐁tr2[(𝐈𝐂)𝐀]𝐁subscripttr2tensor-product𝐈𝐂𝐀\displaystyle{\bf B}\>\operatornamewithlimits{\hbox{tr}\,}_{2}[({\bf I}\otimes{\bf C}){\bf A}] (157)
tr{[(tr2𝐀)𝐈]𝐁}trdelimited-[]tensor-productsubscripttr2𝐀𝐈𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}\left\{[(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A})\otimes{\bf I}]{\bf B}\right\} =\displaystyle= tr[(tr2𝐀)(tr2𝐁)]trdelimited-[]subscripttr2𝐀subscripttr2𝐁\displaystyle\hbox{tr}\,[(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf A})(\operatornamewithlimits{\hbox{tr}\,}_{2}{\bf B})] (158)
tr{[𝐈(tr1𝐀)]𝐁}trdelimited-[]tensor-product𝐈subscripttr1𝐀𝐁\displaystyle\operatornamewithlimits{\hbox{tr}\,}\left\{[{\bf I}\otimes(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A})]{\bf B}\right\} =\displaystyle= tr[(tr1𝐀)(tr1𝐁)]trdelimited-[]subscripttr1𝐀subscripttr1𝐁\displaystyle\hbox{tr}\,[(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf A})(\operatornamewithlimits{\hbox{tr}\,}_{1}{\bf B})] (159)
(𝐀𝐁,𝐂𝐃)tensor-product𝐀𝐁tensor-product𝐂𝐃\displaystyle({\bf A}\otimes{\bf B},{\bf C}\otimes{\bf D}) =\displaystyle= (𝐀,𝐂)(𝐁,𝐃)𝐀𝐂𝐁𝐃\displaystyle({\bf A},{\bf C})({\bf B},{\bf D}) (160)
𝐀𝐁normtensor-product𝐀𝐁\displaystyle||{\bf A}\otimes{\bf B}|| =\displaystyle= 𝐀𝐁norm𝐀norm𝐁\displaystyle||{\bf A}||\>||{\bf B}|| (161)

Identities 150-153 are seen to be special cases of identities 154-157. If we define the superoperators 𝐓1subscript𝐓1{\bf T}_{1} and 𝐓2subscript𝐓2{\bf T}_{2} by

𝐓1𝐀subscript𝐓1𝐀\displaystyle{\bf T}_{1}{\bf A} \displaystyle\equiv 1n1𝐈(tr1𝐀),tensor-product1subscript𝑛1𝐈subscripttr1𝐀\displaystyle{1\over n_{1}}{\bf I}\otimes(\hbox{tr}\,_{1}{\bf A}), (162)
𝐓2𝐀subscript𝐓2𝐀\displaystyle{\bf T}_{2}{\bf A} \displaystyle\equiv 1n2(tr2𝐀)𝐈,tensor-product1subscript𝑛2subscripttr2𝐀𝐈\displaystyle{1\over n_{2}}(\hbox{tr}\,_{2}{\bf A})\otimes{\bf I}, (163)

then identities 158-159 imply that they are self-adjoint:

(𝐓1𝐀,𝐁)=(𝐀,𝐓1𝐁),(𝐓2𝐀,𝐁)=(𝐀,𝐓2𝐁).formulae-sequencesubscript𝐓1𝐀𝐁𝐀subscript𝐓1𝐁subscript𝐓2𝐀𝐁𝐀subscript𝐓2𝐁({\bf T}_{1}{\bf A},{\bf B})=({\bf A},{\bf T}_{1}{\bf B}),\quad({\bf T}_{2}{\bf A},{\bf B})=({\bf A},{\bf T}_{2}{\bf B}).

They are also projection operators, since they satisfy 𝐓12=𝐓1superscriptsubscript𝐓12subscript𝐓1{\bf T}_{1}^{2}={\bf T}_{1} and 𝐓22=𝐓2superscriptsubscript𝐓22subscript𝐓2{\bf T}_{2}^{2}={\bf T}_{2}.

Appendix B Factorization of Harmonic oscillator into uncoupled qubits

If the Hilbert space dimensionality n=2b𝑛superscript2𝑏n=2^{b} for some integer b𝑏b, then the truncated harmonic oscillator Hamiltonian of equation (80) can be decomposed into b𝑏b independent qubits: in the energy eigenbasis,

𝐇=j=0b1𝐇j,𝐇j=2j(120012)j=2j1σjz,formulae-sequence𝐇superscriptsubscript𝑗0𝑏1subscript𝐇𝑗subscript𝐇𝑗superscript2𝑗subscriptfragments1200fragments12𝑗superscript2𝑗1subscriptsuperscript𝜎𝑧𝑗{\bf H}=\sum_{j=0}^{b-1}{\bf H}_{j},\quad{\bf H}_{j}=2^{j}\left(\mskip-3.0mu\begin{tabular}[]{cc}${1\over 2}$&$0$\\ $0$&$-{1\over 2}$\end{tabular}\mskip-3.0mu\right)_{j}=2^{j-1}\sigma^{z}_{j}, (164)

where the subscripts j𝑗j indicate that an operator acts only on the jthsuperscript𝑗thj^{\rm th} qubit, leaving the others unaffected. For example, for b=3𝑏3b=3 qubits,

𝐇𝐇\displaystyle{\bf H} =\displaystyle= (2002)𝐈𝐈+𝐈(1001)𝐈+𝐈𝐈(120012)tensor-product200fragments2𝐈𝐈tensor-product𝐈100fragments1𝐈tensor-product𝐈𝐈1200fragments12\displaystyle\left(\mskip-3.0mu\begin{tabular}[]{cc}$2$&$0$\\ $0$&$-2$\end{tabular}\mskip-3.0mu\right)\otimes{\bf I}\otimes{\bf I}+{\bf I}\otimes\left(\mskip-3.0mu\begin{tabular}[]{cc}$1$&$0$\\ $0$&$-1$\end{tabular}\mskip-3.0mu\right)\otimes{\bf I}+{\bf I}\otimes{\bf I}\otimes\left(\mskip-3.0mu\begin{tabular}[]{cc}${1\over 2}$&$0$\\ $0$&$-{1\over 2}$\end{tabular}\mskip-3.0mu\right) (171)
=\displaystyle= (720000000052000000003200000000120000000012000000003200000000520000000072),fragments7200000000fragments5200000000fragments3200000000fragments120000000012000000003200000000520000000072\displaystyle\left(\mskip-3.0mu\begin{tabular}[]{rrrrrrrr}$-{7\over 2}$&$0$&$0$&$0$&$0$&$0$&$0$&$0$\\ $0$&$-{5\over 2}$&$0$&$0$&$0$&$0$&$0$&$0$\\ $0$&$0$&$-{3\over 2}$&$0$&$0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$-{1\over 2}$&$0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$&${1\over 2}$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$&$0$&${3\over 2}$&$0$&$0$\\ $0$&$0$&$0$&$0$&$0$&$0$&${5\over 2}$&$0$\\ $0$&$0$&$0$&$0$&$0$&$0$&$0$&${7\over 2}$\end{tabular}\mskip-3.0mu\right), (180)

in agreement with equation (80). This factorization corresponds to the standard binary representation of integers, which is more clearly seen when adding back the trace (n1)/2=(2b1)/2𝑛12superscript2𝑏12(n-1)/2=(2^{b}-1)/2:

H+72𝐻72\displaystyle H+{7\over 2} =\displaystyle= (4000)𝐈𝐈+𝐈(2000)𝐈+𝐈𝐈(1000)tensor-product4000𝐈𝐈tensor-product𝐈2000𝐈tensor-product𝐈𝐈1000\displaystyle\left(\mskip-3.0mu\begin{tabular}[]{cc}$4$&$0$\\ $0$&$0$\end{tabular}\mskip-3.0mu\right)\otimes{\bf I}\otimes{\bf I}+{\bf I}\otimes\left(\mskip-3.0mu\begin{tabular}[]{cc}$2$&$0$\\ $0$&$0$\end{tabular}\mskip-3.0mu\right)\otimes{\bf I}+{\bf I}\otimes{\bf I}\otimes\left(\mskip-3.0mu\begin{tabular}[]{cc}$1$&$0$\\ $0$&$0$\end{tabular}\mskip-3.0mu\right) (187)
=\displaystyle= (0000000001000000002000000003000000004000000005000000006000000007).0000000001000000002000000003000000004000000005000000006000000007\displaystyle\left(\mskip-3.0mu\begin{tabular}[]{rrrrrrrr}$0$&$0$&$0$&$0$&$0$&$0$&$0$&$0$\\ $0$&$1$&$0$&$0$&$0$&$0$&$0$&$0$\\ $0$&$0$&$2$&$0$&$0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$3$&$0$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$&$4$&$0$&$0$&$0$\\ $0$&$0$&$0$&$0$&$0$&$5$&$0$&$0$\\ $0$&$0$&$0$&$0$&$0$&$0$&$6$&$0$\\ $0$&$0$&$0$&$0$&$0$&$0$&$0$&$7$\end{tabular}\mskip-3.0mu\right). (196)

Here we use the ordering convention that the most significant qubit goes to the left. If we write k𝑘k as

k=j=0b1kj2j,𝑘superscriptsubscript𝑗0𝑏1subscript𝑘𝑗superscript2𝑗k=\sum_{j=0}^{b-1}k_{j}2^{j},

where kjsubscript𝑘𝑗k_{j} are the binary digits of k𝑘k and take values 0 or 1, then the energy eigenstates can be written

|Ek=j=0b1(σ)kj|0,|E_{k}\rangle=\operatornamewithlimits{\otimes}_{j=0}^{b-1}(\sigma^{\dagger})^{k_{j}}|0\rangle, (197)

where |0ket0|0\rangle is the ground state (all b𝑏b qubits in the down state), the creation operator

σ=(0100)superscript𝜎0100\sigma^{\dagger}=\left(\mskip-3.0mu\begin{tabular}[]{cc}$0$&$1$\\ $0$&$0$\end{tabular}\mskip-3.0mu\right) (198)

raises a qubit from the down state to the up state, and (σ)0superscriptsuperscript𝜎0(\sigma^{\dagger})^{0} is meant to be interpreted as the identity matrix 𝐈𝐈{\bf I}. For example, since the binary representation of 6 is “110”, we have

|E6=σσ𝐈|0=|110,ketsubscript𝐸6tensor-productsuperscript𝜎superscript𝜎𝐈ket0ket110|E_{6}\rangle=\sigma^{\dagger}\otimes\sigma^{\dagger}\otimes{\bf I}|0\rangle=|110\rangle, (199)

the state where the first two qubits are up and the last one is down. Since (σ)kj(01)superscriptsuperscript𝜎subscript𝑘𝑗FRACOP01(\sigma^{\dagger})^{k_{j}}\left({0\atop 1}\right) is an eigenvector of σzsuperscript𝜎𝑧\sigma^{z} with eigenvalue (2kj1)2subscript𝑘𝑗1(2k_{j}-1), i.e., +11+1 for spin up and 11-1 for spin down, equations (164) and (197) give 𝐇|Ek=Ek|Ek𝐇ketsubscript𝐸𝑘subscript𝐸𝑘ketsubscript𝐸𝑘{\bf H}|E_{k}\rangle=E_{k}|E_{k}\rangle, where

Ek=j=0b12j1(2kj1)|Ek=k2b12subscript𝐸𝑘superscriptsubscript𝑗0𝑏1superscript2𝑗12subscript𝑘𝑗1ketsubscript𝐸𝑘𝑘superscript2𝑏12E_{k}=\sum_{j=0}^{b-1}2^{j-1}(2k_{j}-1)|E_{k}\rangle=k-{2^{b}-1\over 2} (200)

in agreement with equation (80).

The standard textbook harmonic oscillator corresponds to the limit b𝑏b\to\infty, which remains completely separable. In practice, a number of qubits b=200𝑏200b=200 is large enough to be experimentally indistinguishable from b=𝑏b=\infty for describing any harmonic oscillator ever encountered in nature, since it corresponds to a dynamic range of 22001060similar-tosuperscript2200superscript10602^{200}\sim 10^{60}, the ratio between the largest and smallest potentially measurable energies (the Planck energy versus the energy of a photon with wavelength equal to the diameter of our observable universe). So far, we have never measured any physical quantity to better than 17 significant digits, corresponding to 56 bits.

Appendix C Emergent space and particles from nothing but qubits

Throughout the main body of our paper, we have limited our discussion to a Hilbert space of finite dimensionality n𝑛n, often interpreting it as b𝑏b qubits with n=2b𝑛superscript2𝑏n=2^{b}. On the other hand, textbook quantum mechanics usually sets n=𝑛n=\infty and contains plenty of structure additional to merely 𝐇𝐇{\bf H} and ρ𝜌\rho, such as a continuous space and various fermion and boson fields. The purpose of this appendix is to briefly review how the latter picture might emerge from the former. An introduction to this “it’s all qubits” approach by one of its pioneers, Seth Lloyd, is given in LloydBook , and an up-to-date technical review can be found in Gu09 .

As motivation for this emergence approach, note that a large number of quasiparticles have been observed such as phonons, holes, magnons, rotons, plasmons and polarons, which are known not to be fundamental particles, but instead mere excitations in some underlying substrate. This raises the question of whether our standard model particles may be quasiparticles as well. It has been shown that this is indeed a possibility for photons, electrons and quarks Wen03 ; Levin05 ; Levin06 , and perhaps even for gravitons Gu09 , with the substrate being nothing more than a set of qubits without any space or other additional structure.

In Appendix B, we saw how to build a harmonic oscillator out of infinitely many qubits, and that a truncated harmonic oscillator built from merely 200 qubits is experimentally indistinguishable from an infinite-dimensional one. We will casually refer to such a qubit collection describing a truncated harmonic oscillator as a “qubyte”, even if the number of qubits it contains is not precisely 8. As long as our universe is cold enough that the very highest energy level is never excited, a qubyte will behave identically to a true harmonic oscillator, and can be used to define position and momentum operators obeying the usual canonical commutation relations.

To see how space can emerge from qubits alone, consider a large set of coupled truncated harmonic oscillators (qubytes), whose position operators q𝐫subscript𝑞𝐫q_{\bf r} and momentum operators p𝐫subscript𝑝𝐫p_{\bf r} are labeled by an index 𝐫=(i,j,k)𝐫𝑖𝑗𝑘{\bf r}=(i,j,k) consisting of a triplet of integers — 𝐫𝐫{\bf r} has no a priori meaning or interpretation whatsoever except as a record-keeping device used to specify the Hamiltonian. Grouping these operators into vectors 𝐩𝐩{\bf p} and 𝐪𝐪{\bf q}, we choose the Hamiltonian

𝐇=12|𝐩|2+12𝐪t𝐀𝐪,𝐇12superscript𝐩212superscript𝐪𝑡𝐀𝐪{\bf H}={1\over 2}|{\bf p}|^{2}+{1\over 2}{\bf q}^{t}{\bf A}{\bf q}, (201)

where the coupling matrix 𝐀𝐀{\bf A} is translationally invariant, i.e., 𝐀𝐫𝐫=𝐚𝐫𝐫subscript𝐀superscript𝐫𝐫subscript𝐚superscript𝐫𝐫{\bf A}_{{\bf r}{\bf r}^{\prime}}={\bf a}_{{\bf r}^{\prime}-{\bf r}}, depending only on the difference 𝐫𝐫superscript𝐫𝐫{\bf r}^{\prime}-{\bf r} between two index vectors. For simplicity, let us treat the lattice of index vectors 𝐫𝐫{\bf r} as infinite, so that 𝐀𝐀{\bf A} is diagonalized by a 3D Fourier transform. (Alternatively, we can take the lattice to be finite and the matrix 𝐀𝐀{\bf A} to be circulant, in which case 𝐀𝐀{\bf A} is again diagonalized by a Fourier transform; this will lead to the emergence of a toroidal space.)

Fourier transforming our qubyte lattice preserves the canonical commutation relations and corresponds to a unitary transformation that decomposes 𝐇𝐇{\bf H} into independent harmonic oscillators. As in steady , the frequency of the oscillator corresponding to wave vector κ𝜅{\mathbf{\kappa}} is

ω(𝐤)2=𝐫𝐚𝐫eiκ𝐫.𝜔superscript𝐤2subscript𝐫subscript𝐚𝐫superscript𝑒𝑖𝜅𝐫\omega({\bf k})^{2}=\sum_{\bf r}{\bf a}_{\bf r}e^{-i\kappa\cdot{\bf r}}. (202)

For example, consider the simple case where each oscillator has a self-coupling μ𝜇\mu and is only coupled to its 6 nearest neighbors by a coupling γ𝛾\gamma: 𝐚1,0,0=𝐚1,0,0=𝐚0,1,0=𝐚0,1,0=𝐚0,0,1=𝐚0,0,1=γ2subscript𝐚100subscript𝐚100subscript𝐚010subscript𝐚010subscript𝐚001subscript𝐚001superscript𝛾2{\bf a}_{1,0,0}={\bf a}_{-1,0,0}={\bf a}_{0,1,0}={\bf a}_{0,-1,0}={\bf a}_{0,0,1}={\bf a}_{0,0,-1}=-\gamma^{2}, 𝐚0,0,0=μ2+6γ2subscript𝐚000superscript𝜇26superscript𝛾2{\bf a}_{0,0,0}=\mu^{2}+6\gamma^{2}. Then

ω(κ)2=μ2+4γ2(sin2κx2+sin2κy2+sin2κz2),𝜔superscript𝜅2superscript𝜇24superscript𝛾2superscript2subscript𝜅𝑥2superscript2subscript𝜅𝑦2superscript2subscript𝜅𝑧2\omega({\mathbf{\kappa}})^{2}=\mu^{2}+4\gamma^{2}\left(\sin^{2}{\kappa_{x}\over 2}+\sin^{2}{\kappa_{y}\over 2}+\sin^{2}{\kappa_{z}\over 2}\right), (203)

where κxsubscript𝜅𝑥\kappa_{x}, κysubscript𝜅𝑦\kappa_{y} and κzsubscript𝜅𝑧\kappa_{z} lie in the interval [π,π]𝜋𝜋[\pi,\pi]. If we were to interpret the lattice points as existing in a three-dimensional space with separation a𝑎a between neighboring lattice points, then the physical wave vector k𝑘k would be given by

k=κa.𝑘𝜅𝑎k={\kappa\over a}. (204)

Let us now consider a state ρ𝜌\rho where all modes except long-wavelength ones with |κ|1much-less-than𝜅1|{\mathbf{\kappa}}|\ll 1 are frozen out, in the spirit of our own relatively cold universe. Using the difference-between\bumpeq symbol from Section IV.6, we then have 𝐇𝐇difference-between𝐇superscript𝐇{\bf H}\bumpeq{\bf H}^{\prime}, where 𝐇superscript𝐇{\bf H}^{\prime} is a Hamiltonian with the isotropic dispersion relation

ω2=μ2+γ2(κx2+κy2+κz2)=μ2+γ2κ2,superscript𝜔2superscript𝜇2superscript𝛾2superscriptsubscript𝜅𝑥2superscriptsubscript𝜅𝑦2superscriptsubscript𝜅𝑧2superscript𝜇2superscript𝛾2superscript𝜅2\omega^{2}=\mu^{2}+\gamma^{2}\left(\kappa_{x}^{2}+\kappa_{y}^{2}+\kappa_{z}^{2}\right)=\mu^{2}+\gamma^{2}\kappa^{2}, (205)

i.e., where the discreteness effects are absent. Comparing this with the standard dispersion relation for a relativistic particle,

ω2=μ2+(ck)2,superscript𝜔2superscript𝜇2superscript𝑐𝑘2\omega^{2}=\mu^{2}+(ck)^{2}, (206)

where c𝑐c is the speed of light, we see that the two agree if the lattice spacing is

a=cγ.𝑎𝑐𝛾a={c\over\gamma}. (207)

For example, if the lattice spacing is the Planck length, then the coupling strength γ𝛾\gamma is the inverse Planck time. In summary, this Hilbert space built out of qubytes, with no structure whatsoever except for the Hamiltonian 𝐇𝐇{\bf H}, is physically indistinguishable from a system with quantum particles (scalar bosons of mass μ𝜇\mu) propagating in a continuous 3D space with the same translational and rotational symmetry that we normally associate with infinite Hilbert spaces, so not only did space emerge, but continuous symmetries not inherent in the original qubit Hamiltonian emerged as well. The 3D structure of space emerged from the pattern of couplings between the qubits: if they had been presented in a random order, the graph of which qubits were coupled could have been analyzed to conclude that everything could be simplified into a 3D rectangular lattice with nearest-neighbor couplings.

Adding polarization to build photons and other vector particles is straightforward. Building simple fermion fields using qubit lattices is analogous as well, except that a unitary Jordan-Wigner transform is required for converting the qubits to fermions. Details on how to build photons, electrons, quarks and perhaps even gravitons are given in Wen03 ; Levin05 ; Levin06 ; Gu09 . Lattice gauge theory works similarly, except that here, the underlying finite-dimensional Hilbert space is viewed not as the actual truth but as a numerically tractable approximation to the presumed true infinite-dimensional Hilbert space of quantum field theory.