Controlling the folding and substrate-binding of proteins using polymer brushes

Abstract

The extent of coupling between the folding of a protein and its binding to a substrate varies from protein to protein. Some proteins have highly structured native states in solution, while others are natively disordered and only fold fully upon binding. In this Letter, we use Monte Carlo simulations to investigate how disordered polymer chains grafted around a binding site affect the folding and binding of three model proteins. The protein that approaches the substrate fully folded is more hindered during the binding process than those whose folding and binding are cooperative. The polymer chains act as localized crowding agents and can select correctly folded and bound configurations in favor of non-specifically adsorbed states. The free energy change for forming all intra-protein and protein–substrate contacts can depend non-monotonically on the polymer length.

While some globular proteins have a well-defined three-dimensional structure in solution, it is now clear that many other proteins possess some degree of intrinsic structural disorder and that there is a wide variety of reasons why such disorder may be an advantage for biological function Dunker02a . In many cases, proteins achieve greater order when they bind, thereby coupling the processes of folding and binding Wright09a . A loss of conformational entropy upon binding allows the size of the binding free energy to be controlled, and a flexible unbound structure opens up the possibility of binding to more than one target. Sometimes, however, the presence of disordered chains is directly linked to function. For example, natively unfolded chains in the nuclear pore complex collectively resemble a polymer brush that provides an entropic barrier to transport across the nuclear envelope Lim07a .

Non-specific interactions with polymer chains have also been employed in the last fifteen years to create materials whose surfaces resist adhesion of biological molecules Kingshott99a ; Lai10b . Typically, poly(ethylene oxide) chains are grafted with high density to the surface to provide a steric barrier to the approach of proteins or larger objects such as cells. A similar approach can be taken using oligosaccharide chains, mimicking the non-adhesive role of the glycocalyx in some cell membranes Holland98a . A small number of theoretical Halperin11a and experimental Yoshizako02a-short studies have also considered the effect of grafted polymers on specific protein–ligand binding.

In this Letter, we investigate how the folding of a protein and its binding to a substrate can be controlled using a brush of disordered chains surrounding the substrate. The chains are grafted to a surface around the binding site, providing localized steric competition for the protein. In particular, we would like to know how the nature of this competition depends on the extent to which folding and binding are independent or coupled.

Since we are interested in the generic effect of disordered polymer chains near a binding site, rather than in the details of a specific case, it is advantageous to employ a coarse-grained model that captures the essential ingredients of specificity, excluded volume and the entropy of chains. The proteins were modeled as strings of amino acid residues that occupy adjacent sites on a cubic lattice. A 20-letter alphabet of residues was used, with interactions between non-bonded residues on adjacent lattice sites given by the Miyazawa–Jernigan matrix Miyazawa85a and expressed in terms of a reference thermal energy $k_{B}T_{\rm ref}$, where $k_{B}$ is Boltzmann’s constant. Empty lattice sites are taken to represent water molecules, and the interaction matrix includes an effective treatment of the resulting hydrophobicity of the relevant residues. It has recently been shown that principles similar to those of such lattice models can reproduce accurate protein structures in highly coarse-grained but off-lattice models Coluzza11a .

The substrate was constructed from a rigid geometrical arrangement of residues from the same alphabet as the protein, fixed to the $z=0$ boundary of the simulation cell. The grafted polymers were treated as lattice chains with one end fixed at $z=0$. These ends were placed on a square grid with a spacing of three lattice units in each direction and a narrow ungrafted border around the binding site. The polymers interact non-specifically with each other and with the protein, i.e., the interaction is only through the excluded volume of occupied lattice sites with no energetic contribution. The simulation box was large enough to allow unfolding of the protein into an extended coil when unbound and far from the grafted polymers. The schematic in Fig. 1 illustrates the various broadly defined states in which the protein may be found.

Figure 1: (Color online) Schematic simulation layout. The protein (P) can be structured (s) or unstructured (u) in solution and binds specifically (b) to the substrate (S). Polymer chains (C) grafted around the binding site interact non-specifically (n) with the protein. Periodic boundary conditions apply in the lateral directions (cell size 30 units). The total height of the simulation cell is 150 units. The three fully bound protein–substrate geometries are shown above the schematic and the inset shows a snapshot of protein 2 with polymers.

The protein and substrate sequences were designed by first selecting the folded and bound conformation of the complex and then applying a Monte Carlo (MC) algorithm in sequence space Coluzza04a . Trial changes of a residue at a given site were accepted with the Metropolis probability ${\rm min}[1,\exp(-\Delta E/k_{B}T_{\rm d})]$, where $\Delta E$ is the change in energy caused by the residue change and $T_{\rm d}$ is a fixed “design temperature.” To prevent the sequence from becoming too homogeneous (and therefore non-specific), a further acceptance probability of ${\rm min}[1,(N^{\prime}_{\rm p}/N_{\rm p})^{T_{\rm p}/T_{\rm ref}}]$ was applied, where $N_{\rm p}=N!/(n_{1}!n_{2}!\dots n_{20}!)$ is the number of distinguishable residue permutations before the trial change and $N^{\prime}_{\rm p}$ is that afterwards. $N$ is the number of residues in the complex and $n_{i}$ the number of residues of amino acid $i$. $T_{\rm p}$ is a fictitious “compositional temperature” and parallel tempering was applied in this parameter to enhance exploration of sequence space. The replica with the lowest $T_{\rm p}=T_{\rm ref}/14$ equilibrates to a sequence whose energy is near optimal for the selected conformation Coluzza04a . Folding can be verified by a conventional MC simulation in configuration space.

The extent of coupling between folding and binding can be influenced before the sequence design by the choice of the complex’s geometry. For example, a large fraction of intermolecular contacts tends to make folding conditional on binding, since the protein–substrate contacts will be required for energetic stability. During the design process the coupling can be further controlled by selecting which interactions to include in the energy change $\Delta E$ of the acceptance criterion Coluzza07a . Including only interactions across the interface will again encourage coupled folding and binding, while design of the substrate after independent design of the protein leads to folding away from the substrate followed by a lock-and-key binding mechanism Koshland94a . The ability to fold and the coupling between folding and binding can be checked by ordinary simulation of the designed sequences on the three-dimensional lattice. Table 1 gives the sequences of the three protein–substrate combinations designed for this work. Protein 1 can attain its folded structure in solution without binding, while protein 2 only gains significant order in the process of binding. Protein 3 also has coupled folding and binding but is smaller than protein 2 supplemental . The cooperative folding and binding of proteins 2 and 3 is promoted by large, non-planar protein–substrate interfaces. Using $R_{g}=0.44L^{0.588}$ Li95a to estimate the self-avoiding radius of gyration of the three fully unfolded proteins, we obtain $R_{g}\approx 6.6$, $5.4$ and $3.6$, respectively. However, in solution, protein 1 tends to adopt its folded $5\times 5\times 4$ cuboidal structure with approximate effective radius $5/\sqrt{2}\approx 3.5$. Hence, proteins 1 and 2 have comparable unfolded radii, while proteins 1 and 3 have comparable volumes in solution. The different penetration, folding and binding properties of the three examples are intrinsically linked to their different geometries and sizes.

Table 1: Designed sequences of the three protein–substrate complexes in the Miyazawa–Jernigan model Miyazawa85a . A colon separates the protein sequence from the substrate.

System	Sequence
1	FGCLILWHDGEKDMFPPKEKVRDQAYQMFVCMWRPRERPCFR EKDVEKDFTGCCVMWHDREKDMWNPKEKLRDYHYNMWACMWN HSEHPCGREKTIEKQG:AYGIAIMWQNSQTYCTSQHTINSSL
2	PGTKNKCPCLWTIMICYCENEDGQCFRKNKDHDLWLVMFRYR ENEDFCPLRKNKEPDHWIHMNRYRENDDIQ:QGGSSECVMYM HLWSWLCKSTITPCFYFQERVMSMFVWAWGDKHFTGHQIAIT EKYAGPAYWAVSQKRVALP
3	KEHGHGPMDLDEKRIRWYFCTCKERECACMPMQLQE:DNYSN AYCCKEKTHRVKDPWMFVGQWSI

Despite the simplicity of the model, it is computationally demanding to sample thoroughly the folded, unfolded, bound and unbound conformations of the protein in the presence of the grafted polymers. In addition to the standard corner-flip, branch rotation, crankshaft and translation MC moves for the protein and polymer chains Verdier62a , configuration bias MC was used to regrow the grafted polymers cbmc . To improve the ergodicity of the simulations, a flat-histogram biasing potential Berg92a in the energy was built up using virtual move parallel tempering Frenkel04a ; Coluzza05a . The efficiency of the latter technique comes from its exploitation of information obtained in both rejected and accepted trial moves.

Using this combination of MC methods we have calculated the free energy profiles $F(Q)=F_{Q0}-kT\ln P(Q)$ and $F(Z)=F_{Z0}-kT\ln P(Z)$ of the protein–substrate–polymer systems. Here, $Z$ is the distance of the protein’s central monomer from the brush anchoring surface. $Q$ is the total number of intra-protein and protein–substrate native contacts, i.e., the number of contacts found in the designed structure that have actually formed, and measures progress from the unbound random coil to the fully folded and bound state of the protein. $P(Q)$ and $P(Z)$ are the probability distribution of the order parameters and $F_{Q0}$ and $F_{Z0}$ are arbitrary free energy offsets that have been chosen to fix the free energy of the bulk-like protein states for each system to aid comparisons. Further insight can be obtained by splitting $F(Q)$ into contributions $F_{\rm ct}(Q)$ and $F_{\rm nc}(Q)$ from states that do and do not involve contact between the protein and the substrate. In the latter case, $Q$ equals the number of intra-protein contacts. Although a small number of order parameters can never fully characterize a complex system, $Q$ and $Z$ are an informative and complementary combination. We note that the protein can be unfolded (small $Q$) even when close to the substrate (small $Z$). For most results, a reduced temperature Miyazawa85a of $T^{*}=T/T_{\rm ref}=0.3$ was chosen, where the bound and unbound states of the three proteins both have significant statistical weights.

Figure 2 shows $F(Z)$ and $F(Q)$ for protein 1. In the absence of grafted polymer, $F(Q)$ is steadily downhill at $T^{*}=0.3$. The separate contribution of $F_{\rm nc}(Q)$ (not shown) follows the overall $F(Q)$ closely, but stops abruptly at $Q=136$, which is the total number of native intra-protein contacts. Hence, protein 1 readily folds away from the substrate. In the presence of polymers of length $L=40$, $F(Q)$ exhibits a sudden rise at $Q=136$, which can be attributed to the loss of polymer entropy due to the fact that the protein must touch the substrate, disrupting the brush, to gain $Q>136$. (The small oscillation is due to there being no unbound states with $Q=135$.) This lock-and-key protein attempts to penetrate the brush in its bulky folded state. At $T^{*}=0.4$, the flatter profile of $F_{Q}$ indicates partial unfolding of the protein in solution and weaker thermodynamic driving force towards binding.

Figure 2: Free energy $F(Z)$ of protein 1 with grafted polymers of length $L$ (see legend), at temperature $T^{*}=0.3$. Inset: free energy $F(Q)$ at three temperatures (marked) without grafted polymers (solid lines) and with polymers of length $L=40$ (dashed lines). The data for each temperature are shifted differently on the vertical axis for clarity.

In the absence of grafted polymers, the $F(Z)$ profile shows a simple, sharp dip to $F(Z)=-5.1k_{B}T_{\rm ref}$ on binding. We can account quite well for this binding free energy simply from the binding potential energy of the pre-folded protein and the loss of translational entropy given by the logarithm of the container volume, yielding $\Delta F\approx-5.5k_{B}T_{\rm ref}$. The $F(Z)$ profiles clearly show the barrier introduced by grafted polymers. The height of the barrier saturates at around $5k_{B}T_{\rm ref}$, but its width continues to grow with polymer length. The bound state of the protein is destabilized by a consistent $4k_{B}T_{\rm ref}$.

Protein 2 was designed to gain significant native structure only upon binding with its substrate. Even without polymers, its $F(Z)$ profile in Fig. 3 shows a wider well width than the corresponding sharp dip for protein 1 in Fig. 2. This is a signature of the protein’s relative lack of structure as it approaches the substrate; in an unfolded state, one part of the chain may interact with the substrate even while the central monomer is some distance away. Protein 2’s $F(Q)$ profiles with polymers (not shown) all decrease with $Q$, without sudden jumps, indicating that the onset of its interactions with the polymer brush is not as abrupt as for protein 1. As for protein 1, increasing the length of the grafted polymers introduces a barrier for protein 2 approaching the substrate from large $Z$. However, the height $\Delta F^{*}$ of the barrier grows much more slowly with $L$ for protein 2 than for protein 1, as shown in the inset of Fig. 3. For fairly short polymers, protein 2 experiences a barrier that is only a small fraction of that for protein 1. This may be attributed to protein 2 only gaining its bulky native structure when it is in contact with the substrate. It therefore causes less disruption while penetrating the brush. Hence, relatively short polymers may be able to discriminate between proteins that are structured in solution and those whose folding and binding are coupled.

Figure 3: Free energy $F(Z)$ of protein 2 in the presence of grafted polymers of length $L$ (see legend). Inset: height $\Delta F$ of the barrier experienced by proteins 1 and 2 on approach to the substrate from large $Z$ due to the polymers.

Protein 3 is another sequence that only folds upon binding, wrapping round a peg-shaped substrate to gain its structure. Being smaller than protein 2, it has fewer native energetic contacts to drive its folding and binding. Its smaller physical extent when unfolded also leads to a slightly narrower well width in $F(Z)$ (Fig. 4). As shown by the solid black line in Fig. 5, the free energy $F(Q)$ of protein 3 decreases with increasing contacts $Q$ in the absence of grafted polymers until $Q=47$. To reach higher $Q$, a loose end of the protein must adhere to the substrate, sacrificing entropy. In the presence of grafted polymers, states that touch the substrate are entropically disfavored, and $F(Q)$ is dominated by unbound, partially folded states. Since most such states correspond to the free protein away from the brush, the $F(Q)$ profiles coincide at low $Q$. The effect of removing this contribution is shown in the plot of $F_{\rm ct}(Q)$ in the inset of Fig. 5. Note from the behavior of $F_{\rm ct}(Q)$ at high $Q$ that long polymers strongly enhance folding of the protein once it is in contact with the substrate, relative to the case without polymers, thereby suppressing partly adsorbed states.

Figure 4: Free energy $F(Z)$ of protein 3 with grafted polymers of length $L$ (see legend). The left- and right-hand insets show how the free energy at binding ($Z=3$) and the barrier width, respectively, depend on $L$.

Figure 5: Free energy $F(Q)$ of protein 3 with grafted polymers of length $L$ (see legend). Inset: contribution $F_{\rm ct}(Q)$ to the free energy from protein configurations in contact with the substrate.

A striking feature of the $F(Q)$ profiles in Fig. 5 is the non-monotonic dependence of the overall free energy change for folding and binding, $\Delta F=F(60)-F(0)$, on the polymer length $L$. As expected, increasing $L$ from 0 initially makes $|\Delta F|$ smaller because of the loss of brush entropy on protein binding. This effect is strong, and we were unable to sample $F(Q)$ beyond $Q=39$ for $L=50$. However, for larger $L$, the trend is reversed, with $|\Delta F|$ now increasing with $L$. Inspection of configurations shows that for intermediate values of $L$, the free ends of the grafted polymers are able to collapse onto the binding site, providing an effective steric block. In contrast, longer polymers force each other to stand more upright by mutual crowding, thereby releasing space around the binding site itself. The protein must still penetrate the brush to reach the site but, once bound and folded, it does not disturb long polymers as much as short ones, causing the free energy of binding to become more favorable. This non-monotonic effect can also be seen in the $F(Z)$ profile in Fig. 4. The left-hand inset shows a clear maximum in the free energy of the bound protein, relative to solution (large $Z$). The physical width of the barrier (measured at 10% height) follows the same monotonic (and rather linear) pattern as the other proteins, as shown in the right-hand inset of Fig. 4.

We expect two important conclusions of the present work to hold generally. Firstly, polymer chains around a binding site can assist specific binding by raising the relative free energy of competing states that involve significant non-specific adsorption. Secondly, a polymer brush may be used to introduce a tunable barrier to binding, thereby allowing control of binding and unbinding rates. Furthermore, the barrier can be selective, here acting more strongly on a protein whose solution structure is well defined than on two examples that fold and bind cooperatively. The length of the polymers can have subtle, non-monotonic results on the effect of the brush. Altering the grafting density or polymer topology Sofia98a would allow further tuning of the response. Finally, we note that the non-specific interactions of tethered polymers can be useful for controlling non-biological self-assembling systems Akcora09a-short , for example by providing tunable kinetic barriers to the association of chosen components.

The authors thank the Churchill Foundation of the United States (BMR) and EPSRC, U.K. (MAM) for financial support.